4KVM


Conserved Protein Domain Family
NARP1

?
pfam12569: NARP1 
Click on image for an interactive view with Cn3D
NMDA receptor-regulated protein 1
This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with pfam07719, pfam00515. There is a single completely conserved residue L that may be functionally important. NARP1 is the mammalian homolog of a yeast N-terminal acetyltransferase that regulates entry into the G(0) phase of the cell cycle.
Statistics
?
PSSM-Id: 403685
View PSSM: pfam12569
Aligned: 24 rows
Threshold Bit Score: 611.582
Threshold Setting Gi: 74684957
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4KVM_D           185 QEESEAMLFMNLVILKKDGVEDAYKHLLSIEKKVLDRVAFLETRAEYELYLSKMEEAKSTIYLLLDRNPDNHQYYYNLQR 264 Schizosacch...
XP_975602        187 YEHSELLLYQNLVIQESGDLKEALKHLESSQDQIVDKLTLKENLGELNLKLKNFDKAAKYYEELIQRNPENTMYYNKLIE 266 red flour b...
Q177P1           186 YKHSELLLYQNQVIQESGNYEKALQHLKEYQSQILDTLAVKETMGELCLKLDRHEEAVGIYQDLIKRNPENIAYYQQYLK 265 yellow feve...
XP_001963623     187 YRHSELLLYQNQILIESERLQQALDHLIKYEPQIVDKLAVRETMGDLYIKLQQQEKAVPIFESLIRRNPENVLYYEQYLA 266 Drosophila ...
EEN67330         185 YEHSELLLYMMMIMKEAGMEEQALKHLETYDKQICDVLEVQENKGDLLLKLGRNDESAAIYRELLRRNPENRKYYQGIEA 264 Florida lan...
Q6N069           187 YEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRLKEASEVFKNLIDRNAENWCYYEGLEK 266 human
Q8VZM1           186 IEHTEMILYKVSLLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLLSKVGRLEEANKLYRVLLSMNPDNYRYHEGLQK 265 thale cress
Q5ZDJ3           186 YEHSEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMACILLKLGRFEEAEKTYRSLLFMNPDNYKYFIAVQK 265 Japanese rice
jgi:MICPUN_61872 196 YEVSEMYLFKAMILEEAGAHEEALAVLDKHSNKLVDVIGVLEQRARLYTALGRGAHAEATLRALIAKNTENHGYYRQLEA 275 Micromonas ...
jgi:OSTLU_48350  203 FDASELALFKAKLKRAAGKEKDALALLERGEETIVDKVAYLTFKGEVQVALGMNAAAEETYWKLLERLPDSYDYHEALRV 282 Ostreococcu...
4KVM_D           265 AYgy---------edASGkvlDSAEWLNLYSQLAKRYPKSECPTRLPLEKLE-GDEFLTHVDLYLRKKLKRGIPSVFVDV 334 Schizosacch...
XP_975602        267 AKk-----------lTKP-----EDVVNFYLECSEKYPRAMPPRRLPLNYAV-GEQFKTLVDKYMRRSLSKGVPPLFVDL 329 red flour b...
Q177P1           266 ALq-----------vEKG-----SDVIAAYQKIQTEYPQSFCAKRLPLDVAE-DEAFRSLIDEHLRRNLRKGVPPLFVNL 328 yellow feve...
XP_001963623     267 ARq-----------lTDP-----SAVVAAYRVFQEQYPRALCPRRLPLNVAS-GSEFRIVADEYLRRGLRKGIPPLFVNV 329 Drosophila ...
EEN67330         265 ANp-----------pKTE-----EERLDLYSQTAAQFPRCQSAIRLPLDFTT-GETFERLADQYMRKALKKGVPPLFNNL 327 Florida lan...
Q6N069           267 ALq-----------iSTL-----EERLQIYEEISKQHPKAITPRRLPLTLVP-GERFRELMDKFLRVNFSKGCPPLFTTL 329 human
Q8VZM1           266 Clglys----esgqySSD---QIEKLNALYQSLSEQYTRSSAVKRIPLDFLQ-DENFKEAVAKYIKPLLTKGVPSLFSDL 337 thale cress
Q5ZDJ3           266 CLglyse----ngqySTD---DVDRLCELYSSLKEEYGWSSAVKRIPLDFLE-GEKFQEAADNYVRPLLTKGVPSLFSDL 337 Japanese rice
jgi:MICPUN_61872 276 VLglv--------------dgDVAKLEATYDALAVQYPKSDAVRRLPLDFLS-GDSFAAAVRKYVVGPIRKGVPSLFRNL 340 Micromonas ...
jgi:OSTLU_48350  283 VKglpekvhdgakeiSDD---DIAKLKSLYEEIGSKLQYCAAAKRLPLSFTKaGEEFKKLIVTYVEKPLRKGVPSLFEDL 359 Ostreococcu...
4KVM_D           335 KSLYKDTKKCKVVEDLVSKYASSLSTTNKFSEDD--DNSQIEIPTTLLWTYYFLAQHFDHVGE-------LE--KAEKYV 403 Schizosacch...
XP_975602        330 RSLYTDKSKVEIIENLMLQYVDALKKVGKYSEAEl-NNGPKEPASALLWVYYYLAQHHDYLNQ-------TE--KAVSYI 399 red flour b...
Q177P1           329 RSLYRDEKKVRVITELVEGYHQNLTSSGYFSAADkeQNLPKEPASALLWTLFYLAQHYDHLRE-------SE--KALDFI 399 yellow feve...
XP_001963623     330 RTLHQKSEKATTIEELALQYFENLTRSGHFSREDadAGVPVEPASALVWTALFLAQHYDYMRD-------TD--RALEYI 400 Drosophila ...
EEN67330         328 RAMYPDKDKVAIIERLMLGYQESLKTAEKFNPND---EGEPQPPTAYLWVLYYLAQHFDYLGD-------TT--KALGYI 395 Florida lan...
Q6N069           330 KSLYYNTEKVSIIQELVTNYEASLKTCDFFSPYE---NGEKEPPTTLLWVQYFLAQHFDKLGQ-------YS--LALDYI 397 human
Q8VZM1           338 SSLYDHPRKPDILEQLVVEMKHSIGTTGSFPGSD-----VKEPPSTLLWTLFFLAQHYDRRGQ-------YD--VALCKI 403 thale cress
Q5ZDJ3           338 SPLYEQPGKANILEELFLKLERSIRTSGCFPGSS-----HTEPPSTLLWTLFLISQHYDRRGQ-------YD--IALDKI 403 Japanese rice
jgi:MICPUN_61872 341 KSLYADRAKAAVMGEAFKEIVKALESSGKFPGSD---KSEADVAQCLCYARTLLAYHEDKVGD-------VE--GALRTI 408 Micromonas ...
jgi:OSTLU_48350  360 RNLYENSAKATLLEDIFTDTVRSLKESGKFLSGGa-TKSEDEKKECVMYAVNLLAMHYDEMGRrssdggaKEfaKAIECI 438 Ostreococcu...
4KVM_D           404 DLAIDHT-PTLVELFMTKARISKHKGELQTAMEIMDHARKLDLQDRFINGKCAKYMLRNDENELAAKTVSLFTRNEavgG 482 Schizosacch...
XP_975602        400 DAAIEHT-PTLIELFVTKGRIYKHAGDPQEAYKWLDEAQALDTADRYINSKCAKYMLRANRVKEAEDTCAKFTREGv--S 476 red flour b...
Q177P1           400 NAAIDHT-PTLIELFVTKGRIYKHAGDVLEAVKWMDEAQSLDTADRYINSKCAKYMLRANQIKEAEEICAKFTREGv--S 476 yellow feve...
XP_001963623     401 NVAIDHT-PTLIELLITKGRIFKHAGDPVEAYVWLEEAQSMDTADRYINSKCAKYMLRANMVSEAEEICAKFTREGv--S 477 Drosophila ...
EEN67330         396 ESAIEHT-PTLIELFVAKARIYKHAGDIEEAARWMDEAQSRDTADRYINSKCGKYMLRAGKVKEAEEMCSKFTREGv--S 472 Florida lan...
Q6N069           398 NAAIAST-PTLIELFYMKAKIYKHIGNLKEAAKWMDEAQSLDTADRFINSKCAKYMLRANMIKEAEEMCSKFTREGt--S 474 human
Q8VZM1           404 DEAIAHT-PTVIDLYSVKSRIMKHAGDLTAAAALADEARGMDLADRYINSECVKRMLQADQVPLAEKTAVLFTKEG---D 479 thale cress
Q5ZDJ3           404 DEAISHT-PTVIDLYSIKGKILQHAGNFSAAAALADEARSMDLADRYLNSECVMQMLQADQVGLAEKTAVLFTKDG---D 479 Japanese rice
jgi:MICPUN_61872 409 DSAIASTePKVLECYLAKASFLKHAGDVVGAMNVANEVREMDRADRYLNSYCVKRMLRAGEYETAEKTVALFTRDG---N 485 Micromonas ...
jgi:OSTLU_48350  439 DEAIASN-DSCVELYLNKATILEHAGDLQGAANAAETSRKLDLADRYLNSNCVRHMLRAGRYAYAEQLAAMFARDG---D 514 Ostreococcu...
4KVM_D           483 AVGDLADMQCLWYMLEDGKSFARQKKFALALKRFSTVFKIFDTWADDQFDFHFFAFRKGSLRTYLDLMSWEDSVYDDPSF 562 Schizosacch...
XP_975602        477 AMENLNEMQCMWFETECALAYQRLGKYGEALKKCHETDRHFSEIIEDQFDFHTYCMRKMTLRSYVGLLRLEDVLRGHPFY 556 red flour b...
Q177P1           477 AMENLNEMQCMWFQTECALSYQRLEKWGESLKKCHEIDRHFSEIIEDQFDFHTYCMRKMTLRSYVGLLRLEDVLRRHPFY 556 yellow feve...
XP_001963623     478 AMDNLNEMQCMWFQTECALAYQRMGRWGESLKKCHEVERHFAEIVEDQFDFHTYCMRKMTLRAYVGLLRLEDVLRQHPFY 557 Drosophila ...
EEN67330         473 AMENLNEMQCMWFQSECAGAYRQLTQYGEALKKCHEVERHFQEIVEDQFDFHTYCMRKMTLRAYISLLRLEDIIRKHPFY 552 Florida lan...
Q6N069           475 AMENLNEMQCMWFQTECISAYQRLGRYGDALKKCHEVERHFFEITDDQFDFHTYCMRKMTLRAYVDLLRLEDILRRHAFY 554 human
Q8VZM1           480 QLNNLHDMQCMWYDLASGDSYFRQGDLGRALKKFLAVEKHYADISEDQFDFHSYCLRKMTLRSYVDMLKFQDRLHSFPYF 559 thale cress
Q5ZDJ3           480 QHNNLHDMQCMWYELASGESYYRQGDLGRALKNFLAVEKHYADMTEDQFDFHSYCLRKMTLRAYVSMLKFQDRLHAHEYF 559 Japanese rice
jgi:MICPUN_61872 486 QASNLFDMQCAWFENEAGRCHQRGGRKNRALKYFTAVRKHYDDMEEDQFDFHQYCLRKNTLRHYVQMLRVEDTLYSRRAY 565 Micromonas ...
jgi:OSTLU_48350  515 QATNSFDMEATWFELEAAKCHIRGKKYGRALKYYHAVLTHFDQFIEDEFDFHGYCLRRTSISAYLDLLRAEDRMFARPEF 594 Ostreococcu...
4KVM_D           563 REAAQGSIEIYFALFDLPFAKYSPKLpdfeKLsSGEINEEEEKKIYKKLKKDlSKRLERAEKLKEAdk----------sr 632 Schizosacch...
XP_975602        557 FKAAKCAIEVYLHLFDEPLKDENAEQ----ELnTENLAPSELKKLRNKQRKA-RRKAEQESAQAREaqvkrd---hhhks 628 red flour b...
Q177P1           557 FKAAKCAIEVYLRLFDKPLPAESAEE----ELdIENLPPSELKKLRNKQRKAaKKKAEQENAQAAQanqkk----dqhnk 628 yellow feve...
XP_001963623     558 FKAAKCAIEVYIRLYDKPLKSEATIE----EIdIENLPPSELKKLRSKQRKA-KKKAELESAQAAQaqvkre---qhqks 629 Drosophila ...
EEN67330         553 FKAAKLALETYIHLVDHPLTDEDKAK----DLeLENLSPKELKKLRSKQRRA-AKKAAILEEKKHQqemq-------qqk 620 Florida lan...
Q6N069           555 FKAARSAIEIYLKLYDNPLTNESKQQ----EInSENLSAKELKKMLSKQRRA-QKKAKLEEERKHAererqq--knqkkk 627 human
Q8VZM1           560 HKAAIRAIRCYLKLHDSPKSTAGEDE-------MSKLAPAQKKKIK-KQKKA-EARAKKEAESKSEestas----gasks 626 thale cress
Q5ZDJ3           560 HKAAAGAIRCYMKLHDSPSKSSTEEN-----DeMSKLPPAQRKKLRQKQKKA-EARAKREAEEKQEdetts-----shts 628 Japanese rice
jgi:MICPUN_61872 566 REAARGGVEVYLDLFDNPLPDPAEEE----EKmLAAMSKEERQAYRKKLKKAeEKKAKEDAEKKAReekear---eaekd 638 Micromonas ...
jgi:OSTLU_48350  595 REAARGAITLYVNLFDEPPAKKVADL----EAkLAAMSSDDAAKFREHMRVErEREEAAEKARLEAleeqkkiaaaqesk 670 Ostreococcu...
4KVM_D           633 AKSEDGMPVKYDE---DPLGENLVATSEPLKEAQKCLEKLLPYGDKNPSAYILAAQLYTRLKNFDTASKYLEQA 703 Schizosaccharomyc...
XP_975602        629 RQQGDVEAD--APqldELIPDKLARVEDPLEQAIKFLQPLQKLAKNRIETHLMAFEVYYRKKKVLLMLQSLKRA 700 red flour beetle
Q177P1           629 QRNPNQDGDPEAPqldELIPDKLARPEDPLEKAIEFLRPLQQLAKENIETHLMAFEIYCRRGKLLLMLQSLKRA 702 yellow fever mosq...
XP_001963623     630 KQQANQETDPDAPqldELVADKLERTDDPLEKAIDFLKPLQQLAKERIETHLLAFEVYYRKNKLLLMLQSIQRA 703 Drosophila ananassae
EEN67330         621 GKRKDPDTEQDGPkedDLVPEKLAKVENPLDEAMKFLKPIQMFAHERIETHLLAFEVYYRRGKLLLMLQAVKRA 694 Florida lancelet
Q6N069           628 RDEEEEEASGLKE---ELIPEKLERVENPLEEAVKFLIPLKNLVADNIDTHLLAFEIYFRKGKFLLMLQSVKRA 698 human
Q8VZM1           627 GKR---NVKPVDP---DPHGQKLIQVEEPMAEASKYLRLLQKHSPNSLETHLLSFEVNMRKQKFLLAFQAVKQL 694 thale cress
Q5ZDJ3           629 KSGKKQNARPVDL---DPHGEKLVQIENPLAEGTKYLKLLQNNSSDSLETHTLSFELNMRKQKILLAFQAVKQl 699 Japanese rice
jgi:MICPUN_61872 639 GKKKNQVKRKEDP---DPNGDALLRTKAPLVEAERLLEPLLRHAADFEDTHLLAFEVFVRKGKLLLALRACNAA 709 Micromonas commoda
jgi:OSTLU_48350  671 NKSPKDTPQKVDP---DPVGEALENTNQPLEQAMKFVEPLLKHAADYEETQLLAFEVFIRQGKPILALKTVNEA 741 Ostreococcus luci...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap