Conserved Protein Domain Family
DUF3683

?
pfam12447: DUF3683 
Protein of unknown function (DUF3683)
This domain family is found in bacteria, and is approximately 120 amino acids in length. The family is found in association with pfam02754, pfam01565, pfam02913.
Statistics
?
PSSM-Id: 338356
View PSSM: pfam12447
Aligned: 62 rows
Threshold Bit Score: 159.216
Threshold Setting Gi: 490174842
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y282         18 PRLREIPYNYTSFSDREIVIRLLGESAWQILDELRSERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRQMLIDA 97   Ralstonia sol...
Q3B3I4         14 STPREIPFNYTSAGDRQAIAFLLGADVVRMLDELRERRVTGRSARLLMSIIGEILIHRRNPYLFQELVDSAARRRRLFER 93   Chlorobium lu...
WP_015905366    3 QQEREIPYNYTSAEDDQVIRHLFGQEMVHSIQNLKGSRDTGRSARLLFRFMGDMFIIDRNPFIFQELLDHPKRKNSFFKG 82   Desulfobacter...
CCK80039        2 dltRKIPYNYTSADDDQIIKHLFGFDLLQVIKKLEFQKDTGRSSRLLHRFMGDLFIIQRNPFLFQELVEDPLLKKRLFHE 81   Desulfobacula...
WP_004073476    3 dpFRKIPFNYTSAGDDQIIVHLFGNEILSTIHLLETLKGTGRSSRLLHRFMGDLFIIRRNAFLFQELVEHPMLRRRLFAE 82   Desulfobacter...
WP_011745345   15 AALREIPFNYTSADDRQGILSLLGPDILTLLDELREHRVTGRSARLLMGIIGEILIHRRNPYLFQELVDSSTRRLRLFER 94   Chlorobium ph...
WP_012508376    7 ivPREIPFNYTSAGDRQAISFLLGRDIVQMLDELRDLRVTGRSARLLMGIIGEILIHRRNPYLFQELVNSSTRRRRLFER 86   Pelodictyon p...
WP_012474681    1 --MREIPYNYTSATDRQLLSYLLGEDTVRMLEELKELRVTGRSAKLLMRIIGEVLIYRRNPYLFQDLVDSHARKTRLFEH 78   Chlorobium ph...
WP_012505534   17 pTDREIPFNYTSAGDMQALSLVFDEENVRLLEELRDRRVTGRSARLLMRIIGELLIHRRNPYLYQELIDSHARRVRLFEH 96   Prosthecochlo...
WP_012097806   14 PSVREIPYNYTSADDRQALSLLLGPDLWGKLEELRTRRVTGRSARLLMRFFGEILIHRRNPFLFQELVDSAPRRRRFFRN 93   Anaeromyxobac...
Q8Y282         98 LNHRLAEIEKRRtadqtahndpesdERSRKVEQLVVHARRAVKAFED 144  Ralstonia solanacearum
Q3B3I4         94 AMADLEVIAASA-------------NGETRVTAIVAAVQEEVERFRR 127  Chlorobium luteolum DSM 273
WP_015905366   83 IHKDLDTIDEGS-------------A-DPKVSRVVDELRGYLsllvq 115  Desulfobacterium autotrophicum
CCK80039       82 FKNDLDLIGNRV-------------QQED-VLVVLEQCRLELKRLAk 114  Desulfobacula toluolica Tol2
WP_004073476   83 FENDLFNIAGHA-------------E-HDEVRIVLDACRSALRQLKt 115  Desulfobacter postgatei
WP_011745345   95 ATKELDTIADVA-------------NGEPRVISIIEAVREQLDRFHT 128  Chlorobium phaeobacteroides
WP_012508376   87 ASAELDTIVEMA-------------NGEERVSAIVAALREQLERFRl 120  Pelodictyon phaeoclathratiforme
WP_012474681   79 AFKDLDTIESSA-------------NGEQRVLSIIATLRRIFEEFRA 112  Chlorobium phaeobacteroides
WP_012505534   97 ALKDLDIIESTS-------------NGESRVLAIVSNLRKYFFGFRE 130  Prosthecochloris aestuarii
WP_012097806   94 IEKDLGIVSRNS-------------NGEERVGEVLAASRKLLAAFRA 127  Anaeromyxobacter sp. Fw109-5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap