Conserved Protein Domain Family
P5-ATPase

?
pfam12409: P5-ATPase 
P5-type ATPase cation transporter
This domain family is found in eukaryotes, and is typically between 110 and 126 amino acids in length. The family is found in association with pfam00122, pfam00702. P-type ATPases comprise a large superfamily of proteins, present in both prokaryotes and eukaryotes, that transport inorganic cations and other substrates across cell membranes.
Statistics
?
PSSM-Id: 315144
View PSSM: pfam12409
Aligned: 155 rows
Threshold Bit Score: 44.4304
Threshold Setting Gi: 74862432
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam12409 is the only member of the superfamily cl13797
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121733918    165 EDLTIVIAGFSSTLTGLIIYFTLCVMTLGFAYLLFRWFPRWRVRLIGKPTPLRICQWVAIE--DQWNQFNVYEVGSQQYG 242
48_pfamImport     1 SENEFQVFGYRTKRWRQALCYVGYVLSLGLIRFLLYWKQEMYVWFVCNPCSLEEADILLLRttDEQKKCCMKKVKSFHVA 80
51_pfamImport     1 EDNEMEIFGYRTEGCRKTLCIAGYVFSCGILPLVFYWRPAWDVWANCIPCTLREADVILLRtsDEFQIYSRKKVMWIYLS 80
42_pfamImport     1 DENEMEIFGYRTQGCRKALCLIGSIFSLGMLPLVFYWRPAWRVWANCVPCSLQEADIVLLRttDEFKIYSWKKVMWISLS 80
139_pfamImport    1 EENEMEIFGYRTQCCRKTLCLAGSIFSFGILPLVFYWKPAWHVWANCIPCSLQEADVVLLRttDEFQTYSRKKVMWICLS 80
52_pfamImport     1 -----EVFGYRTQCFRKALCTAGSILSCGILLLVLYWRPEWNVWANCIPCPLQEADTVLLRttDEFQKYTRKKMIYLDTS 75
69_pfamImport     1 EENELEVFGYRSHTLRSALCFIASVLTCGVLWLVFFWRPQWRVWTNCIPCPLQEADTVLLRttDEFQRYIRKKVICLC-- 78
103_pfamImport    1 EENELEVFGYRTQNLRRALCLTASVLTCGVLLLVFYWRPQWRVWANCTPCPLQEADTVLLRttDEFQRYMRKKVICLY-- 78
60_pfamImport     1 -----EVFGYRTQRLQRALCLLTSVLTCGLLQLVFYWRPQWGVWASCLQCPLQEADTVLLRttDEFQRYMRKKVFCLY-- 73
gi 82082056      17 EENEMEIFGYKTQCCRKALCIAGYILSCGALLLLFYWKPEWDVWANCVPCSLEEADVVLLRttDEFRIYSRKNVTWIS-- 94
                            90       100       110       120
                    ....*....|....*....|....*....|....*....|....*....
gi 121733918    243 RpLSTVFa--------DP--ESYFY-DE----DNDPTvSFLRYIDYRYL 276
48_pfamImport    81 N-VSHIAymnnntaekKDskELPVNtEL-----------KVRYMHVQKM 117
51_pfamImport    81 A-LDSSAgltpdhpliADedCIINRa------IMKPD-LKVRCIQVQKI 121
42_pfamImport    81 A-LSSTSgltpdhpliADeeFIINRa------IRKPD-LKVRYIKVQKI 121
139_pfamImport   81 A-LNSAFrlspdnpfiMDeeSIINRaVR----KPDLK---VRCIKVQKI 121
52_pfamImport    76 T-LKALRnknqnetrvADqhSIINKvMS----NPDSK---VRCIQVQKI 116
69_pfamImport    79 --LSTLKfpis--knpGDplVADRHsVInk-aILKPE-LKLRCIQVQKI 121
103_pfamImport   79 --LSTLKclv---nknLEesLVADHhSVinhaVLKPE-LKVRYIQVQKI 121
60_pfamImport    74 --LSTLKfpi---sknPEepLVADRhSVinqaVMKPE-LKLRCIQVQKL 116
gi 82082056      95 --VSGIIks------rLDypSFAEEdSIfskaLMKPS-LQVKSIQVQKI 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap