Conserved Protein Domain Family
CLASP_N

?
pfam12348: CLASP_N 
CLASP N terminal
This region is found at the N terminal of CLIP-associated proteins (CLASPs). CLASPs are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules. In yeast, Drosophila, and Xenopus, a single CLASP orthologue is present. In mammals, a second paralogue (CLASP2) exists which has some functional overlap with CLASP1.
Statistics
?
PSSM-Id: 338324
View PSSM: pfam12348
Aligned: 51 rows
Threshold Bit Score: 176.237
Threshold Setting Gi: 121927626
Created: 31-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2UCC9        339 VEDLFRVLSPAFEgRESEDNWRHREKYITSLRRLTYG-N-APHDFPQPFFTGIKTNLDGIFKAVNSLRTTLSTNGCLLIQ 416  Aspergillus o...
Q1DS65          1 MDARATELLATL--RNGNVSVDVKTTSLAKLKSEIKQ-KhVPDAAISPLFESFR---LAIASQHYSLSSAGFSALGHLLK 74   Coccidioides ...
Q2H0S9          6 TDDQVANLIALL---RADVSIDTKVQQVTVVKSSIKQ-HmVPESCIVPVFEALH---LASSSQHALLVNAGFTALNHLFT 78   Chaetomium gl...
Q0D0S3         77 MDMKVDDLQAAL--TNPNLSIENKYDRLISVKSDIKQ-KnVPASLIPSLFDCLR---LAIAHNNIHIYTAGFATLSHLLK 150  Aspergillus t...
Q17AR9        308 MDEHMKSINTIV--GDKNMDWEKRVDALKKIRSLLMI-N---VQNSPTFTQQLKDLSIAFLDILKELRSQVIREACITLA 381  yellow fever ...
Q55BD8        409 FEYKMNEIIEIL--SNSDTEWSIKLNNILKFQAIIKS-GaCKLSNFIIVFNRIK---ELLALQILDKRSILMKEACLTLS 482  Dictyostelium...
XP_002848749    1 MDERATELLAAL--RNTSLSVDAKIASLTKLKSEIKQrN-VPTSAVGDIFDAIR---LAIASQHASLSAGGFSALGHLLK 74   Arthroderma o...
XP_015575957  221 LIREFEKVASTLV---PEKDWSIRIAAMQRIEGLVLG-G-AAD--YPCFRGLLKQLVSPLSTQLSDRRSSIVKQACHLLC 293  castor bean
XP_001776918  276 LAKEFEKAASML---APTQDWSIRMSAMRRIEGIVVG-G---ATKYSGFLQLLKQLVNPLCDQLADRRSSIVKQACQLLK 348  Physcomitrell...
XP_002146274    1 MEARATELLGTL--KNPNVSVDAKIAALTNVKSDIKQ-KnVPEPAVLPLFESLR---VAISAQHSSLSSAGFSTLAHLLK 74   Talaromyces m...
Q2UCC9        417 DLAKIGGSR-IDPM-VEVIMQNLIKLCGGMKKISAQNGNVSVNDVLANVTYTPRL-LQHVTSACQDKNAQLRLFAAGWLK 493  Aspergillus o...
Q1DS65         75 RLTLQEQHEaIALQ-GRATYQLLLERLGDHKERIRSQAAQAFTDFWPAAS--ADVeHHVLGAALIGKNARAKETSMVWLA 151  Coccidioides ...
Q2H0S9         79 RLVRQDPRS-LTKE-GTRALPLIVEKLGDQKEKFRQLASQALATLYKVAP--VEVeRSVRNIAMVGKNARAKEASLHWLL 154  Chaetomium gl...
Q0D0S3        151 RLFIEELHTeVAAH-ARSLYPTLLERLGDHKERVRALAAQAFADLWKAAP--MDAeKHVLGTALVGRNPKAKEASLTWIL 227  Aspergillus t...
Q17AR9        382 YMSKLLKNR-LDQF-VIYILQELINLIQNSAKVISSAGIIALKYVIKHTH-APKIvPIITQNLMQSKSKDIRSTLCEIMI 458  yellow fever ...
Q55BD8        483 LIAKELEHH-FEPY-LEKYFDVLLKCIVVTTKIVSESSDNCIKCIISSSK-SCKIiPRIYEAISSDKSVIIRSKCTEYLY 559  Dictyostelium...
XP_002848749   75 RLYLQEQTAlIASQ-GRHTYSLLLEKLGDHKERVRAQASQAFADFWQASPTETE--HHVLEVALVGKSPRAKETSMMWLV 151  Arthroderma o...
XP_015575957  294 FLSKELLGD-FEGC-AEMFIPVLFKLVVITVLVIAESADNCIKTMLRNCKVGRVL-LRIADCAKNDRSAILRARCCEYAL 370  castor bean
XP_001776918  349 VLTKELKSD-FDVF-AETFLPVLFKLVVITVLVIAESADACIKSMLQHCK-VARLlPKMVDFAKHDRSAVLRARCCEYLL 425  Physcomitrell...
XP_002146274   75 RLYIQENHH-LVLFhARQLYPICLERLGDHKERLRAQASQAFTDLWIAAP--QDVeAHVLGTALVGKNARAREMSMIWLA 151  Talaromyces m...
Q2UCC9        494 TLLNKQS-HHKSSLEHGGGLa----lLEKSLKRGLTDANPGIREAMRGAFWTFHQMWPARGNNIL--SDLDNKTRHLLE 565  Aspergillus or...
Q1DS65        152 KMTREYG----------LLFr----iYVPALVTCLEDADGVVRDTAKSTVIELFQSAPPRAISDLkkQLIQNNVRKSIA 216  Coccidioides i...
Q2H0S9        155 QMHQEQG----------LQFr----aYVPTMMELLEDADGMVRDVAKSTVIELFRNAPGPAKSDLkkQLKNFKVRPAIE 219  Chaetomium glo...
Q0D0S3        228 SMHTSHD----------LLFr----pYVASLVACLEDADSAVRDTAKSTVVGLFNSAPAHAKADLqrEMAEQHVRKSIV 292  Aspergillus te...
Q17AR9        459 LLFDEWP---TKTLEKNSs------lLRDALRKGISDADSEARRHSRCAFWSFRRHFPDLADNLY--SSLDPATQRMME 526  yellow fever m...
Q55BD8        560 ILLRDLPsSSGNHHHHHHLFekhldsIEKSIRIGVVDANLTARSYSRKVFIQFSLNWPDRSNSLF--STLDPSAQKTIE 636  Dictyostelium ...
XP_002848749  152 KMTK----------ERGVLFr----aHVPSLVVGLEDADSAVRETAKAAVIELFQNAPSRAISDLkkQIQSHNVRRSIt 216  Arthroderma ot...
XP_015575957  371 LILEHWP--DAPEIQRSAd------lYEDMIRCCVADAMSEVRSTARMCYRMFAKTWPERSRRLF--SSFDPVIQRIIN 439  castor bean
XP_001776918  426 LVLERWF--DAPEMQRSAe------lYEDLIKCCCADAMSEVRSLARQCYRVFARCWPDRARRLY--QAFDPVTQKVIN 494  Physcomitrella...
XP_002146274  152 TMTREHN----------ILFr----sHVPSLVAALEDADSGVRDTAKTTIIEIFQNAPSRAKSDLkrQLSEHGVRKSIV 216  Talaromyces ma...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap