Conserved Protein Domain Family
TMF_TATA_bd

?
pfam12325: TMF_TATA_bd 
TATA element modulatory factor 1 TATA binding
This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes. The proteins bind to the TATA element of some RNA polymerase II promoters and repress their activity. by competing with the binding of TATA binding protein. TMF1_TATA_bd is the most conserved part of the TMFs. TMFs are evolutionarily conserved golgins that bind Rab6, a ubiquitous ras-like GTP-binding Golgi protein, and contribute to Golgi organisation in animal and plant cells. The Rab6-binding domain appears to be the same region as this C-terminal family.
Statistics
?
PSSM-Id: 315083
View PSSM: pfam12325
Aligned: 84 rows
Threshold Bit Score: 68.6893
Threshold Setting Gi: 566149754
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0UNG4        763 STAGAGPSVQLVERMSAAVRRLESEKATSKEELARLSAQRDEAREEVVALM--REAEDKRKLDQKVETLESDLKAMEQRY 840  Parastagonosp...
XP_002128838 1028 dTIRGASGSALLENLQSQLKQRDGEIAQLQGEINTLERTRSSMAEEIVRLT--NENEEMEVTVGQVDELTRKLKEVTARH 1105 vase tunicate
XP_002508205  714 SGGAELAVMRATEELQRQIRSKEVEITIVQDRVKQLEASERALSDELVRQT------QLMDEAGDPRQLRAELQELEGRH 787  Micromonas sp...
XP_002298227  351 TMNPYYMKSMTPNAFESALRQKEGELASYMSRLVCIAFFLNFMLKVLLVITylHACEKLRAESALLPGVQAELDGLRRRH 430  black cottonwood
XP_014623436  862 SMSPYYVKSMTPSSFEAALRQKEGELASYMSRLASLESIRDSLADELVKMT--EQCEKLRGEAAVLPGLRSELEALRRRH 939  soybean
AFW79126      330 SNMSYYLRTMTPSAFESALRQKDGELASYMSRLASLESIRNSLAEELVKLT--EQCEKLRTEAAAVPGLRAELEALKQRH 407  Zea mays
XP_002896721    5 lsSNGNTSVLGLSQLQQRLRLREGENRMLKQQLEALEARQKQTTDEIVRLS--TRNALLESGEAQREQTQLELAKLQKHQ 82   Phytophthora ...
XP_010169648  367 DAIRMGAGSSIIENLQSQLKLREGEISHLQLEIANLEKTRSIMAEELVKLT--NQNDELEEKVKEIPKLRTQLKDLDQRY 444  chuck-will's-...
XP_004068897 1029 EAARLSGGSSIVENLQSQLKLREGEIAQLQLEIANLERSRAVMAEELVRLT--NSNDDMEEMVKDIPKLKIQLKDLEQRH 1106 Japanese medaka
XP_011403956    1 -------------------------------MVASLERSRASLTQELATVS--ERNEVLEQKVKMIPDLQQKLKEMSQKH 47   Amphimedon qu...
Q0UNG4        841 ETTLEMLGEKTEKVEELEGDVADLKKIYRELVQTM 875  Parastagonospora nodorum SN15
XP_002128838 1106 DAVLTMYGEKAEEAEELKLDLEDVKTMYRNQIDSL 1140 vase tunicate
XP_002508205  788 IDALELMGETSEENEELKDRVQGLRMEVDRLTEQL 822  Micromonas sp. RCC299
XP_002298227  431 SAALELMGERDEELEELRADIVDLKEMYREQVNLL 465  black cottonwood
XP_014623436  940 SAALELMGERDEELEELRADIVDLKEMYREQVNLL 974  soybean
AFW79126      408 FQALELMGERDEELEELRNDIVDLKEMYREQVDLL 442  Zea mays
XP_002896721   83 VVLLELFGEKEEQVEELQAEVSELKAFYRKQLDTL 117  Phytophthora infestans T30-4
XP_010169648  445 NTILQMYGEKAEEAEELRLDLEDVKNMYKTQIDEL 479  chuck-will's-widow
XP_004068897 1107 NTILQMYGEKAEEAEELRLDLIDVKNMYKTQIDEL 1141 Japanese medaka
XP_011403956   48 EALLQMFGEKAEETEELRMDIEDLKTMYRQQIEDL 82   Amphimedon queenslandica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap