Conserved Protein Domain Family
TMF_TATA_bd

?
pfam12325: TMF_TATA_bd 
TATA element modulatory factor 1 TATA binding
This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes. The proteins bind to the TATA element of some RNA polymerase II promoters and repress their activity. by competing with the binding of TATA binding protein. TMF1_TATA_bd is the most conserved part of the TMFs. TMFs are evolutionarily conserved golgins that bind Rab6, a ubiquitous ras-like GTP-binding Golgi protein, and contribute to Golgi organisation in animal and plant cells. The Rab6-binding domain appears to be the same region as this C-terminal family.
Statistics
?
PSSM-Id: 315083
View PSSM: pfam12325
Aligned: 84 rows
Threshold Bit Score: 68.6893
Threshold Setting Gi: 566149754
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121748497  763 STAGAGPSVQLVERMSAAVRRLESEKATSKEELARLSAQRDEAREEVVALM--REAEDKRKLDQKVETLESDLKAMEQRY 840
gi 198418595 1028 dTIRGASGSALLENLQSQLKQRDGEIAQLQGEINTLERTRSSMAEEIVRLT--NENEEMEVTVGQVDELTRKLKEVTARH 1105
gi 255081973  714 SGGAELAVMRATEELQRQIRSKEVEITIVQDRVKQLEASERALSDELVRQT------QLMDEAGDPRQLRAELQELEGRH 787
gi 566149754  351 TMNPYYMKSMTPNAFESALRQKEGELASYMSRLVCIAFFLNFMLKVLLVITylHACEKLRAESALLPGVQAELDGLRRRH 430
gi 955371649  862 SMSPYYVKSMTPSSFEAALRQKEGELASYMSRLASLESIRDSLADELVKMT--EQCEKLRGEAAVLPGLRSELEALRRRH 939
gi 413946477  330 SNMSYYLRTMTPSAFESALRQKDGELASYMSRLASLESIRNSLAEELVKLT--EQCEKLRTEAAAVPGLRAELEALKQRH 407
gi 301095240    5 lsSNGNTSVLGLSQLQQRLRLREGENRMLKQQLEALEARQKQTTDEIVRLS--TRNALLESGEAQREQTQLELAKLQKHQ 82
gi 704283006  367 DAIRMGAGSSIIENLQSQLKLREGEISHLQLEIANLEKTRSIMAEELVKLT--NQNDELEEKVKEIPKLRTQLKDLDQRY 444
gi 432858541 1029 EAARLSGGSSIVENLQSQLKLREGEIAQLQLEIANLERSRAVMAEELVRLT--NSNDDMEEMVKDIPKLKIQLKDLEQRH 1106
gi 761901316    1 -------------------------------MVASLERSRASLTQELATVS--ERNEVLEQKVKMIPDLQQKLKEMSQKH 47
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 121748497  841 ETTLEMLGEKTEKVEELEGDVADLKKIYRELVQTM 875
gi 198418595 1106 DAVLTMYGEKAEEAEELKLDLEDVKTMYRNQIDSL 1140
gi 255081973  788 IDALELMGETSEENEELKDRVQGLRMEVDRLTEQL 822
gi 566149754  431 SAALELMGERDEELEELRADIVDLKEMYREQVNLL 465
gi 955371649  940 SAALELMGERDEELEELRADIVDLKEMYREQVNLL 974
gi 413946477  408 FQALELMGERDEELEELRNDIVDLKEMYREQVDLL 442
gi 301095240   83 VVLLELFGEKEEQVEELQAEVSELKAFYRKQLDTL 117
gi 704283006  445 NTILQMYGEKAEEAEELRLDLEDVKNMYKTQIDEL 479
gi 432858541 1107 NTILQMYGEKAEEAEELRLDLIDVKNMYKTQIDEL 1141
gi 761901316   48 EALLQMFGEKAEETEELRMDIEDLKTMYRQQIEDL 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap