5AMO


Conserved Protein Domain Family
Noelin-1

?
pfam12308: Noelin-1 
Click on image for an interactive view with Cn3D
Neurogenesis glycoprotein
This domain family is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with pfam02191. There are two conserved sequence motifs: SAQ and VQN. Noelin-1 is a glycoprotein which is secreted mainly by postmitotic neurogenic tissues in the developing central and peripheral nervous systems, first appearing after neural tube closure. It is likely that it forms large multimeric complexes.It has a divergent function in neurogenesis. In animal caps neuralized by expression of noggin, co-expression of Noelin-1 causes expression of neuronal differentiation markers several stages before neurogenesis normally occurs in this tissue. Finally, only secreted forms of the protein can activate sensory marker expression, while all forms of the protein can induce early neurogenesis.
Statistics
?
PSSM-Id: 315069
View PSSM: pfam12308
Aligned: 12 rows
Threshold Bit Score: 145.652
Threshold Setting Gi: 260819750
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5AMO_A         38 TNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLE 117
gi 1025203582  52 PSPEEGWQIYSSAQDADGKCICTVVAPAQNMCNRDPRSRQLRQLMEKVQNITQSMEVLDLRTYRDLQYVRDTENLMKTVD 131
gi 348540649   52 PGSEEGWQVYSTASDPDGRCVCTVVAPARNLCKRDPRSRQLRSLTEQVQNVSQSMEVVDLRTSRDLQYVRDSEPLLRGVD 131
gi 260819750   31 hgSRDTYYVHSTSEDTSGHCTCTVLAPSPDVCSDDAKYHYIKDLEAQVANLTTLVHQLANRTSSALD-IQTTMTLIHNLT 109
gi 831360252   51 PGQDEGWQVYGSAQ---GRCVCSIKTPVPDACAGDPRHTRLQQISAHVLNVSEHMQLLTRRTAGDLQELRSSETILDTLE 127
gi 972975807   23 PSPEEGWQIYSSAQDPDGKCVCTVVAPAQSMCTRDPRSRQLRQLMEKVQNISQSMEVLHLRTERDLQYITKTGSLVSEVN 102
gi 344283347   82 QSPEEGWQLYTSAQAPDGKCICTAVIPAQTTCSRDGRSRELRQLMEKVQNVSQSMEVLELRTYRDLQYVRSMETLMRSLD 161
gi 950918839   30 QSPDEGWQVYTSAQAPDGKCLCTAVIPVQGTCSRDLRSRQLRQLMEKVQNISQSMEVLDLRTYRDLQYVRNTESLMKGLD 109
gi 1040283471  46 ISPKEGWQVYSSAQDPDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLK 125
gi 765170477   26 vGSKEGWQVYSSAQDADGRCVCTVVAPEQNLCSRDAKGRRLKRLLEKVQNMTQSIQILNLRTQRDFQYIMRMENQIKGLR 105
gi 47210197     5 SVPEENWQVYSSAQDSDGRCVCTVVAPQQTVCSRDARTQQLKHLLEKVQNMSHSIEILDQRTQRDLKFVENMEFQLKTLE 84
gi 564340143   54 TNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLE 133
                          90
                  ....*....|....*....
5AMO_A        118 TKFKQVEESHKQHLARQFK 136
gi 1025203582 132 GKLKTASENPRSLNPKSFQ 150
gi 348540649  132 GRLHTYVANPRTLTARSLQ 150
gi 260819750  110 SQLDVLEADRQLLLTeyfs 128
gi 831360252  128 KTLTSAQQNPQELSDRSLQ 146
gi 972975807  103 SKLKVASESTRTLDPKSFQ 121
gi 344283347  162 ARLRVADG---SLSAKSFQ 177
gi 950918839  110 SRLKVATESQKSLNAKSFQ 128
gi 1040283471 126 AKFRQIEDDRKTLMTKHFQ 144
gi 765170477  106 SRFRQVESDRRTHVSKNFQ 124
gi 47210197    85 NKFKDVEDGHESNTARQYK 103
gi 564340143  134 SKFRQVEESHKQHLARQFK 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap