Conserved Protein Domain Family
zf-SNAP50_C

?
pfam12251: zf-SNAP50_C 
snRNA-activating protein of 50kDa MW C terminal
This domain family is found in eukaryotes, and is typically between 196 and 207 amino acids in length. There is a conserved CEH sequence motif. SNAP50 is part of the snRNA-activating protein complex which activates RNA polymerases II and III. There is a cysteine-histidine cluster which contains two possible zinc finger motifs.
Statistics
?
PSSM-Id: 338291
View PSSM: pfam12251
Aligned: 66 rows
Threshold Bit Score: 174.304
Threshold Setting Gi: 126652500
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74857551    813 MDILVLGSHKLTVLRDKIYCLS---D----------------C----------------ILDG--S-----NRKSGFFFI 850
gi 74863968    440 AEYEILSNQTLANLTDVFFCFD---T----------------S----------------NYGL--P-----KCDGSLYFI 477
gi 74982111    402 AEFEILSTQTLANLTDVFFCFD---T----------------S----------------NYGM--P-----KFSGSVYYI 439
gi 1028576884  184 ASVKILGGQTLADLRDVLLCSS---D----------------L----------------ILIG--NeaqntQTRPGYFFI 226
gi 1098427802  214 AEFDVLEYQTLAEIRDAFNCDDskrE----------------E----------------ELLK--V-----KTKGACFFI 254
gi 193573525   165 kTLQFYDTQTLHDLKQGFKCEN---E----------------EseisgdisknphkpleFIVN--S-----DLKHGLFYI 218
gi 156089565   305 rEFDMLSSQTLAELRDAFRCAS---E----------------I----------------RPLNvdL-----KANGSCFML 344
gi 126652500   249 SEFDILETQTLSELSNSFICHD---Skq-------------eE----------------ELLG--F-----HPTGDCFEI 289
gi 901886654   400 AEYEILSSQTLADLTDVFFCFD---S----------------S----------------NYGL--P-----QFEGSVYYI 437
gi 1028722109  145 ntIQFYDTQTLQDLKQVFKCKN---EeseisgdvsnnihkplE----------------FIEN--S-----DLKHGSFYI 198
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74857551    851 NNVFYND-NRD--QR--NYQYSKNTLAWLKERGKDI-S--N-------------FKEESMDDVTFNDLEISIGERYLYCH 909
gi 74863968    478 DGILYPD-LRS--NN--AVDYSTSILNFYKMKkmktnfik-------------ypykinqDKAILSQIEIPLFKKCCFLH 539
gi 74982111    440 DGILYPD-VRD--KD--ALDYSTSIINFYKNRknissstassssnsnlddflkhpykiyqDKAVLKDIKIPLYKKCCFLH 514
gi 1028576884  227 ENTFYVD-LRD---N--AVDCSRVIRSWMELDKESF-GntE-------------IKAARMDETKLWQLSIELNQAYLYMH 286
gi 1098427802  255 DGVLYPD-LREteDG--IINYATYLKGYCNTVNTIG-N--K-------------EEIIPMHKRKLNEISIPINLPCSFLH 315
gi 193573525   219 NNNLYVDsLPD--RS--TLMHAETMKSWASCNGHTI------------------QNILSM-DTQLLDLEVCIGQPYVYQH 275
gi 156089565   345 NGQLFPD-LRN--D---ACDYSEPLLHFLYNYKPGIlR--T-------------SECIEQTDAVLSHLELPIYMPGFLLH 403
gi 126652500   290 NGDLY---LNG--TDdiKSNFINTLSGFTMKSnp---------------------qIFDMKNTQISHLNIPINSHSTYIH 343
gi 901886654   438 DGVLYPD-LRS--PS--ALDYSACILEFYKKKkesnfir--------------ppykvlqHKAVIGQMEIPLYQRCCFLH 498
gi 1028722109  199 NNNIYVD-SSL--V---SMEYTETMKKWACDHght------------------idnILSI-DTQLLDLEVCIGQPYVYQH 253
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74857551    910 QGSCEHLVTFESLRMVN-E-M-DDLEPSRYPIITYQQKVRRRKCLVCDIYAAKYVTLG-DQFADETPFFYCDECYRTFHY 985
gi 74863968    540 QGTCEHRIVFNNIRQYNkL-R-D-KHLSKYPLRTFKPNISNKYCISCHKNIAQKIVLD-SYLLKENPSYMCNNCFDLFLM 615
gi 74982111    515 QGNCEHRIVFSNVRQYNkF-R-D-KDISQYPIRTFKPNIATKYCICCHKNIAQKIIID-SYLFKENPSYVCDGCFELFLL 590
gi 1028576884  287 QGSCGHLMTFDQIGLFN-P-NvDSKYRKDYPISTPITNICMPKCHVCGVFYAKYATVD-DLHTAETPSIWCLDCFNQFHL 363
gi 1098427802  316 SGDCEHRFTFTNIRVYQ-EcV-DCPYEDVYPLQIYSPSTILTFCEICGINLANKLIFN-ALNLPKNPSYLCDSCTFAFLY 392
gi 193573525   276 LGRCEHLFIFNEINIAK-S-N-DCLGQTNYPRVISVAKEKLKNCIFCYKNIASIVMLNdDERTPLTVNHMCESCFKSYNY 352
gi 156089565   404 HGDCEHRLMITAIRIFD-RtR-DCPYEECYPLKVFMPRQRAKQCNVCEYNEPSTTVFN-SLVLPHIPSHLCNYCYTRLkl 480
gi 126652500   344 SGDCEHRVTFTNIRLFNsK-Y-DSPYKDSYPIQIYSHSRTLTFCEICGINQVTKVIFN-SLNLPRNPSQLCDSCTFIFLY 420
gi 901886654   499 QGNCEHRIIFNNIRQYNsL-R-D-GESSKYPLRTFKPNIAKKLCLCCRKNMAQRIVLD-CYLFKENPSYVCNCCFDLFLL 574
gi 1028722109  254 LGRCEHLFIFNEINIAK-F-N-DWLIQSKYPRVVSVEKEKLQKCIFCRKTVATIVMLSeNDRTLQTVNHMCKHCFESYNY 330
                          250
                   ....*....|....*.
gi 74857551    986 sKDG-HLLySNYQVFP 1000
gi 74863968    616 dKNN-QPIdTSMKYFD 630
gi 74982111    591 dSNG-KPVdDMMKHFQ 605
gi 1028576884  364 nPSG-QPrynvqlrei 378
gi 1098427802  393 dKETrNPL-ENFiicn 407
gi 193573525   353 dHLD-DKV-SDFKAYR 366
gi 156089565   481 lessggvyrsdglass 496
gi 126652500   421 dKNT-K---QSIEKCI 432
gi 901886654   575 dRQG-HPVdALMKHFA 589
gi 1028722109  331 dDFG-NKI-SNFKc-- 342
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap