Conserved Protein Domain Family
DUF3584

?
pfam12128: DUF3584 
Protein of unknown function (DUF3584)
This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.
Statistics
?
Aligned: 9 rows
Threshold Bit Score: 1251.14
Threshold Setting Gi: 81355875
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Maqu_4086    33 ILHNSFdqVK-GRTiRIDCRERTHIGGANGAGKTSTLSLIPAFFGEEPERIVSRNsgRLSFVDYYLPNQQSLLIFEYRRY 111  Marinobacte...
Q15TM5            8 ILINCH--LP-GFV-ELDVSGHSNICGTNASGKTTLQRLIPVFYGELPSKVVPKT--RKKFDEFYLPHANSYLIYEYQRE 81   Pseudoalter...
vbi:Avin_39070    8 ILINTH--LQ-GVV-ELVVDDHTNICGTNASGKTTLQRLVPVFYGEYPSRVVPAT--RDSFERWYLPTEQSFIVYEYQRM 81   Azotobacter...
Q8EAA0            1 MLIDTH--LP-GVV-ELALNGHTNICGTNASGKTTLQRLVPVFYGEYPSRVVPST--RDSFERWYLPHDSSYIIYEYQKA 74   Shewanella ...
jgi:Sama_0592     8 VLIDTH--LP-GVV-ELALDGHTNICGTNASGKTTLQRLVPVFYGEYPSRVVPST--RDSFERWYLPHDSSYIIYEYRRG 81   Shewanella ...
ABM03623         12 IIIDSF--WK-GQVnELNLTGHTQLEGTNGAGKTSLMRLLPLFYGMRPSDIVSKVdqAHNFADYYLPRDSSMLVYEYQRP 88   Psychromona...
Q481D9           12 IIIDSF--WQ-GQVnELDLTGHTQLEGTNGAGKTSLMRLLPLFYGMRPSDIVSKVdqAKNFADFYLPRESSILVYEYARP 88   Colwellia p...
Q5NWU4           12 ILIDSY--RK-GDIgEVRLDGHVNVNGINAAGKTTLLRTIPLFYGEAAARMLKGEqgKKAFTDHYLPRSTSYIVFEYARR 88   Aromatoleum...
Q21PY3           12 NIRNPNggLPsGRIaELDPRGGVLAVGVNGVGKTTLLRLLPLFYGATPQQILRGTg-RALMIKYALPDPSSAVAYEYERE 90   Rhodoferax ...
jgi:Maqu_4086   112 SG--LCCSVMYRHhSGkLC--YRFVEGGAKDTFFAPGTHELLMAGGTNQEVFDHLRGNGASMSPMIDtITDYRAIIQNNP 187  Marinobacte...
Q15TM5           82 DGq-ECQVVLTRK-GS-DGvqYRLIDAPYKSEQILVEMENGEAQAMLPEQWIKQLRQLQIDFSHKIQaTSEFRGIIQNDA 158  Pseudoalter...
vbi:Avin_39070   82 DGq-LCQAVLAAA-SDgRGvtYRLVQKGFELDDYVKNRQGDAIVCLSMEELGRRFRQGGVNTTRLIN-TTQFRAIIQNDR 158  Azotobacter...
Q8EAA0           75 DGl-LYQAVLASA-GDgKGvnYRFIAKGFELSDYIKSQNGDTILCHTMAELGRDLKRQGIATTNLLN-TREYRAIIQNDR 151  Shewanella ...
jgi:Sama_0592    82 DGm-LYQAVLSSN-GDgKGisYRFIAKGFELDDYVKARNGDALVCHTAAELGREMKRAGIAHTNLLN-TREYRAIIQNDR 158  Shewanella ...
ABM03623         89 FSq-TCMVIAS---SDgRGvhFKFIDGAYNSEYFIAENN----KPYPVSDVDKFYRNAGCDRSIFLG-VDKYRQVIQNLR 159  Psychromona...
Q481D9           89 FGq-KCQVLAT---SDgRGvhFKFIDGAYDSQLFISSTQGSKAKPFTISEIEKNYRNIGKESSKFLG-IDKYRQVIQNLR 163  Colwellia p...
Q5NWU4           89 -Gq-LCMAVLHSN-VTgESvqYRFIAAGYRRALFVIGQS----IVESNTQLIRHVEKQGIQCTRALT-RGEYRSIIQND- 159  Aromatoleum...
Q21PY3           91 SEtdLRTVVMHCKpGDd-ApqFHIIRGGYREDFFYDANN-QFVTREEFKAHVEAMDNNKYQVSQKLY-LHQYRSVILNER 167  Rhodoferax ...
jgi:Maqu_4086   188 KLLRrQPAEARRLRGLAADYSLGGRDTQMSHIDRLTHVVLNRSRLLSSFKTMICETQFEnihLQTRP--------KPIDE 259  Marinobacte...
Q15TM5          159 SVGG-TGRENTKLRQLASRYSLVSSAHRIRHMEKLVSAVHAKEGKMDTLRTMLAAIFEE---DGLVQptt---tvKNTKA 231  Pseudoalter...
vbi:Avin_39070  159 SLLA-ADGQRAELRGWARQFSLCDPEHSLRHIEKLARAVHSREGKMETIKSMVAAILEE---DGVSPpat---hlNLQRV 231  Azotobacter...
Q8EAA0          152 TLLS-TGSNRSELRAYARQFALCDGEHSLRHIEKLAKAVHSKEGKMETVKSMIAAILEE---DGVNPpss---rlNPQRV 224  Shewanella ...
jgi:Sama_0592   159 TLLS-SGTNRVELRSYARQFALCDAEHTLRHIEKLAKAVHSKEGKMETVKSMIAAILEE---DGVNPpts---riNPQQV 231  Shewanella ...
ABM03623        160 S-----GRKLKEVYLLQKRYSF--SDQPCPHIDKVINGTIEKNLDFDAVKRMLVAIASDhlaRNSVDekeq-islKKEEI 231  Psychromona...
Q481D9          164 S-----GRKHKEIRVLQNRFSF--SEQACPHIDKVINGTIEKNLDFEAVKRMLVAIASDhlaRNTSDekeq-lslNKADI 235  Colwellia p...
Q5NWU4          160 -------VERRELRSLAGQFAFTGSGSRLSHVDRIVTGMFVRAATFRDLRAIIVSSIAQ---DE-GQlei---raQRDQM 225  Aromatoleum...
Q21PY3          168 LAT----KEGVKMRELAAMHSL--GPSPLYNLDQIAAAMANEKISFRDLENIVIERVTDahfDGNVPnnsreikkSRGDV 241  Rhodoferax ...
jgi:Maqu_4086   260 QGLVQDIKSLKAFEKEEASIRECLKQDAERQGILERARVTAGDLVATIEESREKKTEWLGAAQKIRQSAQEMDDAFSEAA 339  Marinobacte...
Q15TM5          232 REWITQMRQTMRLQSMQGDYEKIQEQTEQLNVIEQQLLLLKPLLEQDLQHLTTEKADGQEQKNNYKTQQRAEKDIFEQAE 311  Pseudoalter...
vbi:Avin_39070  232 EDWIRDSRLIQGFNAIRPEFERLEREYQDLLGGELRLAGLLFGYKADEPRLFQSQEETEASIERSGFQLRQLEEGWKERR 311  Azotobacter...
Q8EAA0          225 EAWIRESQLIQGFEVIRPEFEKLEQEFNQLLSAEMRLSSLSRGYRNDESLEADRLEIQQTLSKELNLKLRMLDDEWKEVR 304  Shewanella ...
jgi:Sama_0592   232 ENWIRECQLIAGFEEIRPEFDKLEQEFNQLLSAELRLAGLHKGYKDDEVLEAERQERCQTASKEYNFRLRQLDDEWKEKR 311  Shewanella ...
ABM03623        232 SHWLADIQAGRAIQKVAHKITLWQNDFSSLESLLLKLQHLHFEIVSHQTRIESLQKERAETKADKRQLLISLEKQLQESV 311  Psychromona...
Q481D9          236 TNWLADIQASRAIKKVADKISVWQNDFSAFASLVNKLQHLHAETLAHQERLEVKQQQRDELKRSSIANRSSLESELANTI 315  Colwellia p...
Q5NWU4          226 DVWIHDHDAYVDVMNEAGRVAGLAEASKTRESAIASLSLTKGHLMALERASSTQLQAVKEGLNALEEQVATDRAQVAQKS 305  Aromatoleum...
Q21PY3          242 ARWLEDRDHLARIMANRPEALKIQARIETVKTLHLELCTLHVAVKEAILQIAREQEEFDARQARLKSEFDTKTDDINTLI 321  Rhodoferax ...
jgi:Maqu_4086   340 STRSQEIQAKSHKLDILKRDLDGIYESRDDHEDKGLPKLSQDLDNLPEYERSHRDAQGDLNRVTSKVQALQNEHDRDVGV 419  Marinobacte...
Q15TM5          312 GELNSRLSETNEQLSAKSSRLDHLQQQYEKYQDSDIEQLQKDMDALPLTREEYEQTLEQYNLLIEQHKDLQSQLEQQKFK 391  Pseudoalter...
vbi:Avin_39070  312 DALNQELSAARGDIGRIEDELEQIERQYQGYLDADIEQAKADLEQVGAWRDEMANLDARHRLLTERHQDVERAWLERQQA 391  Azotobacter...
Q8EAA0          305 DELNLDLSAAKGDVAKCEYELDAIEDQHGAFLDANIEQAKADLDMLPNWRADMENLSERHKLQTEKHQDIEAAYNARRSK 384  Shewanella ...
jgi:Sama_0592   312 DELNQEISAARGDVSKFEHELEVIEDQHGAFLDADIETAKGDLEQLPLWRTDLENLSERHKLLTDKHQDVEAAYNARRSK 391  Shewanella ...
ABM03623        312 DRLNGELFTLKAKIQADQSHIDLLDEDKLIFDQDDAPSYHLHAEQAPQIQNELNEVNAIIEAFEGNINKIQQKFDRLIQN 391  Psychromona...
Q481D9          316 EKYQKAISDLNAKIEADLSKIELLDDDKFNYDDDDASSYQIKADQAPQIQAELTEVIAVIDAFEGNITKIGQKFDKLIQK 395  Colwellia p...
Q5NWU4          306 AETRGRLSAQDEALKQARAQLERLDAQAKRYQDERLETRAQDQERLPSVQSELELQEKSLAALLGSQRSVTEEYERLELL 385  Aromatoleum...
Q21PY3          322 AAATGDKKTADAAWANKREEVEAAESRLRQFEKIGVEKLAAEQSNEDSFSSQCSAMERELDGLTTAAGDVTRKTQTRKAA 401  Rhodoferax ...
jgi:Maqu_4086   420 IKNRFQEEQEKRNNR----VRDEKAALasaKHDFDKDLSAINAQQVKQEGALKEARANERAKLTNRLVREETLRDSTGQT 495  Marinobacte...
Q15TM5          392 LSESLERLSRKNQASvk-vIRQQKETV---RQTHHEKESALRSQFEQRKEQQGSEFEQQLMDVERSIVRQEHQAKHASAT 467  Pseudoalter...
vbi:Avin_39070  392 IKDQRELALEQLRGQee-aLREERDER---KARQDEALHALESAFVARRQEGLEDFNRREYERRLERDRLDQRSRNLGYS 467  Azotobacter...
Q8EAA0          385 IGEQLNRELEGLHSEqd-kQREARDKQ---REVARGDLDALEAQWRSQMDAGKASFSEQEYQFKLNAAELKLRVDGVTYT 460  Shewanella ...
jgi:Sama_0592   392 IVEQLNRDLEVLDQDld-kQRDARERQ---AAAARSDLEKLEQFWRDQLEAGKNRFREEEYELKLAASEEKLRQDAVTYT 467  Shewanella ...
ABM03623        392 RKLENVTDIAGNKDKta-nIKETAALQ---LTVISDVYQQQCNELNEQLNQQNLNLKIGQERIESALENAKFQLNQAIIE 467  Psychromona...
Q481D9          396 IEVEKLKALSTNKERsaqiTSESNGQ----LAHINEVFHQQEQSLNAQLHKEELKLQKDQQHFQHQLSSAQQQLTQPTIP 471  Colwellia p...
Q5NWU4          386 ADQRNKAKIADIEKGra-pIYEEIDRL---KAECEAHYQGLESALRHEHEGALREANEEAKGYAERIGWLNGRINDAQAS 461  Aromatoleum...
Q21PY3          402 VSSDCADVVSRINERlleaSREGKVRGdelHAAEENALEALESPLR------ITEINDAKLLLISRLGELKVLLASPTAT 475  Rhodoferax ...
jgi:Maqu_4086   496 PEESQRITGAEAAVRKAEAEARKAEDDLGQENAKCEQARQDRNTAQEILQKAEDSLNDLRAAASDLKRQITPDTGSWLSQ 575  Marinobacte...
Q15TM5          468 DEEMENGALADKRLELAQRAWQQSSGAKKQAEALHQQCQHKRDEADKTLHRARLATRQSKDHLQQLHKQLSPEQDSLRQF 547  Pseudoalter...
vbi:Avin_39070  468 EEENLALAILDRRLEEADERVEAAEARVRHLETQERGLRARREEAHGAFTLGARRLVERQEQLDEIELMLYPGQHTLLEF 547  Azotobacter...
Q8EAA0          461 EEEKLNLAIFDERIHRADEEQESCNAKVERLTSDERKLRAKRDQANEALRIASLRVNERQTALDELHHMLFPQSHTLLEF 540  Shewanella ...
jgi:Sama_0592   468 EEEKLNLAVFDERIERADEEQEASNANVERLALEERRLRSRRDQASEALRLASIRVSERQNALDELKTMLFPQSHTLLEF 547  Shewanella ...
ABM03623        468 PELLTDIENNQVLLNAAQEKQTQRFKEQSSLQSELTQFDKLREKQSDKHQQENRYLEQLRSECAEVELQLIPKAGSLHHY 547  Psychromona...
Q481D9          472 LELTTDIEENVIAFSQAQQSYNQLLQQESALQKQQYQLDKQQDKQLTLRSEANRYLEQLRQDYHQVELQLLPQADSLHHY 551  Colwellia p...
Q5NWU4          462 PELVMQKEAKDDECEKARSTLEAARKGREDAQRARLAAKTRFDEADRHLGRIHARLQEQKGALQAAMQVGDAAPGTLIHF 541  Aromatoleum...
Q21PY3          476 SDTLEQQRQSVSAVDHMREALGKATASVLAAQDELAVARGASDNALVRLNDCEQAALQVAQRDEQLQEQLSPPAGSLLAF 555  Rhodoferax ...
jgi:Maqu_4086   576 L-RQH--DPEWGERLAKIINPKLLERTDLQPQRHGGD-RP-D--LVMGWSLALDNLPVPDFAANED------ELQARLKA 642  Marinobacte...
Q15TM5          548 L-RDN--KPGWEQSIGKLIVEPLLERKDLSPKLVETS-DE-Q--HLLGVQLDTSVIDAPAYAQDET------ALRVALQQ 614  Pseudoalter...
vbi:Avin_39070  548 L-RRE--QPGWESRIGKVIHPELLKRADLKPALGDDG-EG-G---LFGVHLDLAALEVPGYAASEA------ELRQRLQL 613  Azotobacter...
Q8EAA0          541 L-RKE--AQGWEQSLGKVIAPELLHRTDLHPSVTGES----D--TVFGVNLDLKAIDVPEYAASEQ------ELRIRLSK 605  Shewanella ...
jgi:Sama_0592   548 L-RKE--APGWEEHLGKVIAPELLHRTDLHPF-NASS-GA-DgnSLFGIGLDLKALDIPEYAQSEQ------ELRSRLAK 615  Shewanella ...
ABM03623        548 L-NNEplAGDWKQSIGRLLSSAQLGRCDLDPEW-----VG-GelNFYGLKLDLQQIQHNDSLFLNEt-----QLREKRDA 615  Psychromona...
Q481D9          552 L-INEpqAADWQKTIGRLLTTEQLSRTDLNPQWLESI--N-ApaSLYGLSIDLQQLPCDDSLFLDEa-----QLREKRQV 622  Colwellia p...
Q5NWU4          542 L-RSQ--VPDWRENIGKLASRELLLRTDLVPEVDEAQ--K-Q--NLYGVRLRLDRIEAP-WHAHEE------TIEARIAQ 606  Aromatoleum...
Q21PY3          556 LrSTD--AALWSDS-AKVIDTALLCRTDLDPVLVDGSaPSpGelTLGSVTLHVERVDVPSWVDMTDvrqqitALKREADV 632  Rhodoferax ...
jgi:Maqu_4086   643 LDEQIASAVAHRSQAEKSAQDRNATYTDRQRAVAHRITEKKLTDDLLERARNHQDTARREIELAIADRKQAHERQVRQLN 722  Marinobacte...
Q15TM5          615 ATKHLLAAEKEQKSAEAELDQLHQEAEMQREVVAERNRAFEQAEQEVSYAQSAKQRYSDELKIVLQKRRQQAQAALDTLL 694  Pseudoalter...
vbi:Avin_39070  614 AQDALQDAENQQKETEARLVEANAALEESQRQLVVARSEAQNRRDDRQRLKEERRAQKDRLDAAVAERRSQARRQLVELD 693  Azotobacter...
Q8EAA0          606 AEEALQSAQELQAEAESQLVAINGELDKLSRELTFARTAYKNSRDDLRRLFDEKRSEQDKINKALAERKAFAQQRLTQLD 685  Shewanella ...
jgi:Sama_0592   616 AEEALGSAREVQEAAEEQLVTINGELEKLSRELTFARTAFKNAREDLRRLFDEKRAEQDRVNKALAERKQLAGKRLVTIE 695  Shewanella ...
ABM03623        616 LETTYQTQSDKIKQIDEQLAQLSKQIENQQLKMTRAAQGLKQNELNLQQLNVQHQNLAVKKQRAIKAHIDSVNEQINSLE 695  Psychromona...
Q481D9          623 IETKLQTQTDKITQLDEQLKSLAKEINQLKVSASEHAQSVNQKKLTMGQLQTQQESLVVKKQLAIKAHRQTIETQLQIFN 702  Colwellia p...
Q5NWU4          607 FKSDIDAEHARHAAQESALGQARAALDAADKAEEDALRTYQGADERLGRLSGEQQSLKRQLEESRTRAKKQAEEERRDVA 686  Aromatoleum...
Q21PY3          633 VSKALQDARSSAQRLSKEMSLANVKVGEAKAGESLAKAALENARLTQIRWTNVMEQEKLACTQQTESEQRKKVTSVQKLD 712  Rhodoferax ...
jgi:Maqu_4086   723 EQIGQFDEQTREMLKALADDFSQRTVYRKAEWAETSAEIEESIQNAIKLAENAQTEHEHRLETMKVAYDQRLQDNDIDPS 802  Marinobacte...
Q15TM5          695 QEKKQILEQKADAIALLKSDYDEQLLEFKSGWQDEVAVLDEQIDELEKQVEQKRQQNREQIKQLEEAFNQELANKDIDPN 774  Pseudoalter...
vbi:Avin_39070  694 GALELLVAERDAWLAELKSRYGEERLETSAHWQQVLGSLDNQIRQLKAAAEARRAGARAELEECERWYRDELKSRGVDEN 773  Azotobacter...
Q8EAA0          686 GELKQLKHQHQLWLEEQKEQALEARMEKQAYWQEVIGALDNQLGQIKATIDARRESAKAEQKACETWYKNELKSRGVDED 765  Shewanella ...
jgi:Sama_0592   696 HQLKQLGRDHQDWLEETKEESLEARMEKNAYWQEVVGALDAQIASVKTGIESRRANAKAETKACEQWYKNELKSRGVDED 775  Shewanella ...
ABM03623        696 KQKKVNDKKQQAFSEQQQGQKSELSTQMLEKRLVVESDRDVQLDLLSEALLALESGHKARIKALQKQNDTDLDKLDPDGE 775  Psychromona...
Q481D9          703 QQLKALEKKQHSFEENKAEQLHELTNDKLEKCMVVESDRDNQLTLLSEQLVALITSAKQRTAELKKQQTSDIKHLDPEGE 782  Colwellia p...
Q5NWU4          687 AQQKALELEIKQMLAAFDRTLRENTTARQQALKALEGTKKDKLAAIVAAIAKEQTALAAQLDGLKTERHRSLAAKGIDPQ 766  Aromatoleum...
Q21PY3          713 AEANLLLNGLKAAKQHIRDDFRTHR-------RVVVEETSAAEARLDQEKAAAYVQRDRHLSQIDEDMARDLAGLGVDPI 785  Rhodoferax ...
jgi:Maqu_4086   803 IVRELRNKVEELQHTIEGIRDHEPVIREYRAWLKKDWARvkeltgEVAALGSEVESLGKAHEKLQKDHREAIKVKTNEAK 882  Marinobacte...
Q15TM5          775 TLKALKQKTESLKSLIQTVTSRREELNEYKAFMQSDWLK------QRPMLLEQEAELKASAQQLTQQQSTLQRQYQNKRT 848  Pseudoalter...
vbi:Avin_39070  774 AIVELKRQMKALGERIARTEQRRDEVLRYDDWYRHSWLA------RKPKLQGQLGESRDLAADLEQRLGGASTAYKAERG 847  Azotobacter...
Q8EAA0          766 NILKLKQQIRELETKISRAEQRRSEVLRFDDWYQHTWLI------RKPKLQTQLSDVKRAASEIDQQLKAKTQEVKTRRQ 839  Shewanella ...
jgi:Sama_0592   776 KIVGLKADIRTLERKIADAEGRRADVLRYEDWYQHTWLS------RKPRLAEELAKVRRAQSELEQQLARLSAEVKTQRS 849  Shewanella ...
ABM03623        776 VD-KRSRERKNLIRSLERCAVFEQKARSYFQFMNERYSQrdslaeHNQNRKITKRNTEQSIEELQINLGKQISDTKLFIK 854  Psychromona...
Q481D9          783 VDKSIAKRVQ-LEKNLQQCSVFAQKARDYQSFINERYCHrdalveENQNRKIIKRNLESNFEDSNIELTTKINDLKLLIR 861  Colwellia p...
Q5NWU4          767 TLSRLETEIATLHATIEQIRKDGPAIAQYHVWLQSQW-P------QRPAYVAQVETIETEVRRLKDELARIQADAERRNA 839  Aromatoleum...
Q21PY3          786 RVADLARGIEDFTQRLENIARNRHEVTEWRRFQRETFPLmestrlERDRLATRCSEINSKLLDLRGDLTRLEESTRLDLA 865  Rhodoferax ...
jgi:Maqu_4086   883 QLEDKAKTLNQQIDQADHTIR-NFRDGFEQP-AANGFPKDLITLT-----------SDLQDDCRRLGRLRGDVLKAFIRA 949  Marinobacte...
Q15TM5          849 ELSQALSAIEKRLSACSALIT-EIEPMVRQL-ANIAFSFKANDESdinlgdqaeriSRCTEALESRSRGEKKLKEALSEF 926  Pseudoalter...
vbi:Avin_39070  848 RLEEGRQRAVQLKGQLDEALG-RLRTLLRRL-GELKLPREASPAEgeld----erlRLGEELLQARERQLAAIKAHVERF 921  Azotobacter...
Q8EAA0          840 QLETERKASDAAQIEASENLT-KLRAVMRKL-AELKLPANNEEAQgslg----erlRQGEDLLLKRDYLMGSVKQYVEHF 913  Shewanella ...
jgi:Sama_0592   850 ELESGRKASDAAQVEASENLT-KLRSLLRKL-ADLKLAPTDDEAQgsig----erlRQGEELLLKRDYLVGSVKQYVEHF 923  Shewanella ...
ABM03623        855 KLNMQSHASEDLLVLLNESHR---DCEQSGInATFAEHQPSNQADlsis----fcnDCLEQFKSIHKRLSEQLNKFNDRF 927  Psychromona...
Q481D9          862 KNNQEKQATDDLLVQLNDNKR---LCEMSAIeSELSEQEPANQADltvs----fchDFYQQFKTIEKRLATQLNTFSERF 934  Colwellia p...
Q5NWU4          840 AFMKELDALEKQEHRIDGELS-GVRLRIERL-AFVREDADAAQAAheaa----htlAYLDELKRTNESAKLDAEKKIEDD 913  Aromatoleum...
Q21PY3          866 NIERNRGSNRKQADRLTELLRlGLKDFMSYVpNRLHVDWNVESLE-----------AAVSDFRDKLAGESEAIQKELRNL 934  Rhodoferax ...
jgi:Maqu_4086   950 QGVL----NDYNGTQIYQSWQKHlqyrRGTLSDPAmeydEAFKLeqLQDLRLLLDTD--VPHLRSaVIEQFAAHAGSLKD 1023 Marinobacte...
Q15TM5          927 EANL----GKDAGKDFLDTMLQA----FSVLDEDA----NVRDR--LPILQRLLSIL--ASRQRQ-IVEQGETIGGDLNK 989  Pseudoalter...
vbi:Avin_39070  922 DGLI----AGQSGSGLAETWERSra-eCTQVGERGipslDYRRL--VPHLAELLNVL--VPQKIAaLRDLGKNFGIELNH 992  Azotobacter...
Q8EAA0          914 DSVI----ASKSGSGLAETWERAre-eSSFINDKGirllDYRKL--VPQLEQLLNVI--VPQSIMaLREQGRIFGVDLTA 984  Shewanella ...
jgi:Sama_0592   924 DTVI----AAKSGSGLAETWERAre-eATSINDKGirilDYRKL--VPSLEQLLNVM--VPQSIMaLREQGRIFGVDLTA 994  Shewanella ...
ABM03623        928 K-------KDHSASELYENWQKLvadnDHYQGAELl----------FKYRSPIADLLssAEQKQKsTYQLVTVNANMINE 990  Psychromona...
Q481D9          935 R-------KDHSGSELFDNWQKLlldnDSYSGAKAl----------FKYREPISELLnsAEQKQQsTYQLVTVNATMINE 997  Colwellia p...
Q5NWU4          914 VGVIlrafTKHRGTAPDRFYESYrs-dLATQSKGG------REW--LPAIQEWFGSR--HLEARRvLRDGASLLGQTVDE 982  Aromatoleum...
Q21PY3          935 KNVM------LMRSGPVEHWLSLk---ERELPDKQtlldHEWQCalAQVVCDWFDPReyVPYVDQvHKEMVSFLDLA-GG 1004 Rhodoferax ...
jgi:Maqu_4086  1024 YFDGLESMAREVKRVSNQLRRKINTDQQIESISDIRVELQARIEDDDSWRPLKAFVT---QWGDWH-A--LHPreIPSDS 1097 Marinobacte...
Q15TM5          990 FFTVFSDINRKISLQSKRLTDEVSDDLTLDGIARSEVKIISTVDELNFWTPLKRFAE---QYDNWNkS--DAF--LPSET 1062 Pseudoalter...
vbi:Avin_39070  993 YYEVLADIDRKIDTQSARITREVGEELFLDGVSESAVRIRSRIGELEFWPELKAFIK---AFRAWr-E--DGYgeLPGED 1066 Azotobacter...
Q8EAA0          985 FYDVLADIDRRIASQSARITREVGEELFLDGVSESAVRIRSKISELEFWPELEQFVK---AFKNWk-A--DGFngLPDEE 1058 Shewanella ...
jgi:Sama_0592   995 FYDVLADIDRRIASQSARITREVGEELFLDGVSESAVRIRSRISELEFWPELEVFVA---AFRRWk-S--DGFagLPDEH 1068 Shewanella ...
ABM03623        991 FYQHIENFGQRIKQIGKKLSNNVTALTHFEALAEINVTTVMKQEELDYWGPLQVFAK---AFELYRdQlrEGVgeIPDE- 1066 Psychromona...
Q481D9          998 FYQHIENFGRRIKQIGKRLSTKVTALAHFEALADISVTTVMKQEELDYWGPLQKFAE---VFELYKdQlrDGLgdVPDD- 1073 Colwellia p...
Q5NWU4          983 FYGALSTFKNRTQSFSRELQTCIDSSADFEKITNVQARIQTTVDTLNYWPSIRALSE---EFRLWv-E--RQDddLPHQE 1056 Aromatoleum...
Q21PY3         1005 FVRTLDLFDRRVDSFNRELQKALSETAKFERFRDLSVTVRSGVGQISSLKTLRQMQDvanSKGSLHrSvvVQEreVPSDE 1084 Rhodoferax ...
jgi:Maqu_4086  1098 IITAFQRVTDTLKS-ASvGQNIESMIDMKLVMKENDREVSIRNDNDFLNASSEGLTYLAIMAVFMGMTRYLCP--DLNTR 1174 Marinobacte...
Q15TM5         1063 YLDTLADVVEVLPN-DA-NYSIESLLRLELHLNEGGSDLVIKNDRQLLESSSHGMAYLILCKFLLAFTRLLRN--QANID 1138 Pseudoalter...
vbi:Avin_39070 1067 YTGSMRRTLDIVGR-SAlGGGIAGLLEIELRLREGNSDLVIRTDRQLNESSSHGMAYLILCKFLLAFTRLLRG--AAPAV 1143 Azotobacter...
Q8EAA0         1059 YTNSMRRALDIIGR-AAlTGGISKLLEIELRLKEGNSDLIIRTDRQLNESSSHGMAYLILCKFLLAFTRLLRG--RADVT 1135 Shewanella ...
jgi:Sama_0592  1069 YTNSMRRALDIIGK-AAlSGGIAKLLEIELRLREGNSDLIIRTDRQLNESSSHGMAYLILCKFLLAFTRLLRG--SAQVT 1145 Shewanella ...
ABM03623       1067 LVQAMQRLSAYLPS-EGfVLAHNNLFDIEFTITEKGHVKHARNAKQLKKVSSTGLSYLAMLSLFAGLLGMLRGsgENRSQ 1145 Psychromona...
Q481D9         1074 LVFAMQKLASYLPN-EGfVLAHNNLFDLEFTIVEKGQVKHARNAKQLKKVSSTGLSYLAMLSLFAGLLAMLRGdsKHASQ 1152 Colwellia p...
Q5NWU4         1057 FCQALRRVSQCFEReSTlSADLVDLIQLEIDLVENGRHVTVRDEKTLEHVSSNGISYLILIVLFLGFLQRVRK--DAPVQ 1134 Aromatoleum...
Q21PY3         1085 ETALIREFRNILPSdGVfMVNLNDQVRLECSLIENGQRKIITNEDEFRAVSSSGNTALITAMYLIGFVQMVRGp-NSPVR 1163 Rhodoferax ...
jgi:Maqu_4086  1175 ITWPVDEIGKLDPTNISRLASMLERNNLTMISACPELNRPLEQFFENKISIKA 1227 Marinobacter hydrocarbonoclasticus VT8
Q15TM5         1139 IHWPIDEIGTLAYHNVEKLFAACDTNHINILGAFPNPESDVLMLFKHRYLIDK 1191 Pseudoalteromonas atlantica T6c
vbi:Avin_39070 1144 VHWPIDELGTLHHNNVKKIFDACSNNNIRILGAFPNPDSEVLSLFANRYIVNK 1196 Azotobacter vinelandii DJ
Q8EAA0         1136 IHWPIDELGTLHHTNVKKIFDACGNNNISVLGAFPNPESEVLNLFVNRYIINK 1188 Shewanella oneidensis
jgi:Sama_0592  1146 VHWPIDELGTLHHNNVKKIFDACENNNISVLGAFPNPESEVLSLFKNRYIINK 1198 Shewanella amazonensis SB2B
ABM03623       1146 IILPVDELGELAAENVDLLLQMFNDNNISMLSASPSTDRHILSLYQRHYKLKD 1198 Psychromonas ingrahamii 37
Q481D9         1153 IILPVDELGELAAENIDLLLQMFNDNHISMLSASPSTDRHILSLYHRHYKLKD 1205 Colwellia psychrerythraea 34H
Q5NWU4         1135 VVCAVDELKNLDLANTERLFNLLDRHRVTLISAFPDADPEVLRLFAHRYTILE 1187 Aromatoleum aromaticum EbN1
Q21PY3         1164 LTWVVDELGRFDSDNLAAFLHTLDWHKIDVISASPSVDPALARYFPRLCVFEN 1216 Rhodoferax ferrireducens T118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap