Conserved Protein Domain Family
DUF3567

?
pfam12091: DUF3567 
Protein of unknown function (DUF3567)
This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved EIVDK sequence motif.
Statistics
?
PSSM-Id: 338243
View PSSM: pfam12091
Aligned: 24 rows
Threshold Bit Score: 105.791
Threshold Setting Gi: 506247934
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q221E1         1 MH-TLYDSDTYSVTHMLANAVAT-------DAtpdvsldrtepvrivptlARHGFEIVDKRANKEVYLDGSWAELFQQHI 72  Rhodoferax ferr...
Q12GD5         1 MH-MLYDSDSFVVVQIHANAPEE-------SApapa----------vpqlARHGFEIVDKRSGKEVYLDGSWAEMFQQRL 62  Polaromonas sp....
WP_013107593   1 MQtMIYDSDAFCVLQLDWSGSQEsrtdhetDL------------------SRGGYEIVDKFARKEIFLGGRAAEGFRASV 62  Thiomonas
WP_015012290   1 MH-MLYDSESFVVVHMLPDAVEK-------KStqalndt----apavpqlARHGFEIVDKRSGKEVYLDGSWAEMFQEQI 68  Acidovorax sp. ...
WP_011808778   1 MH-MLYDSESFVVVHMLPDVLEP-------DPqdpqaln----dtsvarfARHGFEIVDKRSGKEVYLDGSWAEMFQAQI 68  Verminephrobact...
WP_013902999   1 MQ-MLYDSDSFVVVHMQANAPAE-------GEpep-------------riARHGFEIVDKRTNREVYLDGSWADAFQRQI 59  Ramlibacter tat...
WP_022776500   1 MH-TLYDSDSFSVTHVLANAVPA-------DVspdataage-plrvvpqlARHGFEIVDKRSGKEVYLDGSWAEIFQRKI 71  Candidatus Symb...
WP_011793899   1 MH-MLYDSDSFVVVHMQPDTGEA-------EApagvp--------pvhqlVRHGFEIVDKRSGKEVYLDGSWAEMFQQQI 64  Acidovorax
WP_003068569   3 M---LYDSESFAVLHLRPDMEAD-------VPagkakae----teqahqlPRHGFEIVDKRSGKEVYLDGSWAEMFQKQI 68  Comamonas
WP_012203054   1 MQ-MLYDSESFVVLHLRPDMDPD-------ATagneav------dtarqlPRHGFEIVDKRSGKEVYLDGSWAEMFQKQI 66  Delftia
Q221E1        73 SAWQQNTPTQEEVEDTLEQYAELAQNPVLVH 103 Rhodoferax ferrireducens T118
Q12GD5        63 SAWAQKTPTQEEIEDTLEGYSGLANTPISLH 93  Polaromonas sp. JS666
WP_013107593  63 QQLIAQEPSSEEIDDFLDRYSALSRQSLHAH 93  Thiomonas
WP_015012290  69 LAWQRETPTQEEVEDALDRYAGLAQHPVVVH 99  Acidovorax sp. KKS102
WP_011808778  69 LAWQRKTPTQEEVEDALDRYAGLAQNPVVVH 99  Verminephrobacter eiseniae
WP_013902999  60 NAWQLNTPTQEEVEETLDGYAELAQNPLVMH 90  Ramlibacter tataouinensis
WP_022776500  72 SAWQRQTPSQEEVEETLEQFASLAQNPVLIH 102 Candidatus Symbiobacter mobilis
WP_011793899  65 LAWQRDTPTQEEVDDTLDGYVGLAQNPVVVH 95  Acidovorax
WP_003068569  69 LAWQQDAPTEEEVEEILDTYTGLAQQPVIIH 99  Comamonas
WP_012203054  67 IAWQLDAPTEEEVEDALDRYAGLAQQPVVVH 97  Delftia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap