Conserved Protein Domain Family
DUF3552

?
pfam12072: DUF3552 
Domain of unknown function (DUF3552)
This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with pfam00013, pfam01966. This domain has a single completely conserved residue A that may be functionally important.
Statistics
?
PSSM-Id: 314881
View PSSM: pfam12072
Aligned: 52 rows
Threshold Bit Score: 148.465
Threshold Setting Gi: 123069110
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5FL81   7 IPVATAIVSLLVGTVTGYAIRKHSWEQKAQNAQNDADHILADAkaqvaaaeaevnaqkqaaiavKQSAENTKKEKILEAQ 86  Lactobacillus acidoph...
Q8KEF5   9 LIIAASIVFFVVGFYIGRFFLERIGTTKVLEAEERAVQVIQEA---------------------QKEANDYKELKVNEVN 67  Chlorobium tepidum TLS
Q3AQC9   9 LLVLAALVAFVAGFFIGRYFLERIGTTKVLEAEERAVQIVQEA---------------------QKEANEYKELKVSEVN 67  Chlorobium chlorochro...
Q313W7   4 IEIVLLLVGMAVGAATGFILHKIVSAKRLQDARELADRIIEEA---------------------RKEAQAHKKEVLIQGQ 62  Desulfovibrio alasken...
Q728D2   4 mIFAYIAIGAVLGAGTGYLLHRYVSAKRIGDANELAKRIVEEA---------------------RKEAQAQKKEILLQGQ 62  Desulfovibrio vulgari...
Q3A218   5 IQWIGIGAAFLVGAIGGALVRRKVAATQLAEAKRMADQILSEA---------------------TKEADILRKEAEIQKK 63  Pelobacter carbinolic...
Q74E27   5 LAIIFIVLAAGAGFLIGNLLRKKLSDSLVSKAEELASRIVEDA---------------------KREAETISKEAALQAK 63  Geobacter sulfurreduc...
A5GAT3   6 MTMILAVIAAAIGFLIGNLLRKKSSDAIVASAEELAAKMVEES---------------------KRQAETITKEASLQAK 64  Geobacter uraniireduc...
A8F8V8   1 MIILVAVVTAVISFGLGYVVAKSRIEQKNRKAQQDAVSLLKKA---------------------EQEAQEIKRKAIIEAR 59  Pseudothermotoga lett...
A6LM64   3 IYILSG-LGVLVGALLGYVVAKRNIEKQLLLAKKDAEHIIKDA---------------------EKEASEIKKKAVIESR 60  Thermosipho melanesie...
Q5FL81  87 EQIRDYRQKTEDELNSKKDNLARQENRLQQREDTLDHKNSLLDEREAGLTEKEDQlkqqnasLKAKLDEADELVGIRRQK 166 Lactobacillus acidoph...
Q8KEF5  68 QEWKKRKREFDSEVTIKNNKFAQLQKQIRQKEVTLANQMRDIKETEKKLQEQREElkhqtqnVQNRSAELEKTILEQNQR 147 Chlorobium tepidum TLS
Q3AQC9  68 QEWKKKRREFEQDVLIKNNKFAQLQKQLQQREAQLKKQSQDVRDAERKLQDQRKEveqlsdsVKLRATELERVIVEQNQR 147 Chlorobium chlorochro...
Q313W7  63 DELFNQKRELEREFKEREHELKIRERRLQEQTERLEEKLEKLAQKEHDALSVEKElnrrertLGLKEEELTQKIAEQDKK 142 Desulfovibrio alasken...
Q728D2  63 DEIFNQKRELENEFKERERELKARDRKLEEQGERLEEKLEKATQKEHEVLAIEKEltrkerrLATLEEELEGKIAEQDHR 142 Desulfovibrio vulgari...
Q3A218  64 DALLEAKTAWEQEAREMRRELQAQEKRLVQREENLDRKVAQVDARDEEFGQREKRlsqqesrIRSWEKEADALVRQQRER 143 Pelobacter carbinolic...
Q74E27  64 DVVYQAKADFEREAKEKHKDLQTLEKRLQQKEENLDKKMNLFDQRDADLTKKEQGilareqsLNRKEESLDALVAEQRAK 143 Geobacter sulfurreduc...
A5GAT3  65 DVVYQAKADFERETKDKRRDLQALEKRLQQKEENLDKKMNLFDQRDAEFLKREQGlaakeqvLGQKDEKLNQLISEERTR 144 Geobacter uraniireduc...
A8F8V8  60 EEVHKIKEEIEEEKKRRDLEHRSLEERLLKREEIISKREELVDKKETALEQLRVQleaakkkIEQREKELDE-------R 132 Pseudothermotoga lett...
A6LM64  61 EELHKLREEWEKERKEREEEIRYLEERLIKREEMVSKREELLDKKENYVEELRKEldqrqrdLEAKEKELTE-------R 133 Thermosipho melanesie...
Q5FL81 167 LYDVAKLDKDQAKKIVLDQLSDELVKERAEMIRNSNEEVMAKADRYANQVIIDAIQSSAADT 228 Lactobacillus acidophilus NCFM
Q8KEF5 148 LESISNLTAEEARQMLIDNMIAKAREEAAETVHQIHEEATQKADRIAEKIMLTAIQRISFEQ 209 Chlorobium tepidum TLS
Q3AQC9 148 LESISNLQADEARQMLIDNMVTQAREEASNTIHRIHEEAEQQATRMAEKTLITAIQRISFEQ 209 Chlorobium chlorochromatii CaD3
Q313W7 143 LQEISGLTSEEAKARIFSEVEARTRHEAGKMIRVIETEAKETASRSAQKILATAVQRYAGDF 204 Desulfovibrio alaskensis G20
Q728D2 143 LEEVSGLTAEEARARIMEEVEARTRHESAKMIRVIEMEARETADRKAKEILASAIQRYAGDY 204 Desulfovibrio vulgaris str. Hildenborough
Q3A218 144 LEELAGLGAEEAKAQLMEQMESEARHECAKKIKQIEDEAKEAADKKAQEILALAVQRYAGDF 205 Pelobacter carbinolicus DSM 2380
Q74E27 144 LEQISGMSSAEAKKILMDAMESEAKLDAAKRIKAIEEEARETADKKSKEIISLAVQRYAGEY 205 Geobacter sulfurreducens PCA
A5GAT3 145 LENISGMTAAEAKKILMETMENEAKLDAAKRIKAIEEEARETADKKSKEIMALAIQRYAGEY 206 Geobacter uraniireducens Rf4
A8F8V8 133 FTKLAGMTVEEARQIVIDEARQKYEHDLAILYKKIKENYEEEAEKEAKKIIATAVQRYAPEY 194 Pseudothermotoga lettingae TMO
A6LM64 134 FEKLAGITPAQAKEMVLEEAREKYEYEIAKVYSQIKARYEEDSEKYAKKVIADAIQRYAPEY 195 Thermosipho melanesiensis BI429
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap