Conserved Protein Domain Family
DUF3461

?
pfam11944: DUF3461 
Protein of unknown function (DUF3461)
This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 130 amino acids in length. This protein has two conserved sequence motifs: KFK and HLE.
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 181.789
Threshold Setting Gi: 123535061
Created: 24-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A1SSV2         2 YSNLKSIGVVNYDNIDKYTLRQEGDTDILKIYFRKASR--QFLAKSLKFKFPRQRKKISQDH-G-SSGFRNVSEIGSTLR 77  Psychromonas in...
Q2SPM9         2 TDHLKHIGVADPQRIEKYTLRTEAENDILKIYYKKEKG--DLFHRSLKVKFPRLQKQLLVDSgG-AKRYENTSEIAPNLL 78  Hahella chejuen...
A0KHF9         2 YENLKSLGIQEPTSVDSYTLRQEANHDILKIYFKKQKG--EFFAKSVKFKYPRQRKTMLVDS-G-THEYKDVTEINANLK 77  Aeromonas hydro...
Q6LN21         2 YPHLTSIGIEQPEAIERYSLRQEAANDILKVYFAKNKG--ELFAKSVKFKFPRQRKSVLVNS-G-SREYKEITEINRTLT 77  Photobacterium ...
Q7MIF7         2 YPHLTGLGIHDPSQIERYSLRQEAHKDVLKIYFHKQKG--EFFAKSVKFKYPRQVKNVLVDS-G-SHQYKEVTEINRNLT 77  Vibrio vulnific...
WP_014293624   5 YPTLAQMGITSFDNISRYQLRREGRADVLKIYYHRPKG--SLLSRSKKFTFARPGSLGPVEF-QkTEQWHSLEDTSPVLR 81  Oceanimonas sp....
WP_011978562   2 YPTLQSMGITSIQDIEKFTLRYEGGHDVLKIYYRREKG--SLLPKSKKFKFGRSTKTVLADG-G-QQTYRQVQEPSLIVL 77  Marinomonas sp....
WP_015465739   2 FPHLATISITNTHEIKRYSLRHEGVYDILKIYFKKERGshQIFSRSVKFKFPRQNKKINSDT-Q-PNSFENISEINASLR 79  Psychromonas sp...
A1SSV2        78 YVLKELDSL----TE--HVKEEKELKVQVLEDLKHLESVVASKIKEIERKLEQM 125 Psychromonas ingrahamii 37
Q2SPM9        79 HVLDELDKI----TS--KETEQVDVKEKILKDLRHLERVVNNKIKEIERDLDKL 126 Hahella chejuensis KCTC 2396
A0KHF9        78 YVVDELDNL----TQgvHVQADPDIKQKILRDLRHLEKVVQNKISEIERDLEKL 127 Aeromonas hydrophila subsp. hydrophila AT...
Q6LN21        78 HIIDELDII----TK--RKHTEVDIKKKILGDLRHLERVVSHKISEIEADLEKL 125 Photobacterium profundum SS9
Q7MIF7        78 LVIDELNKI----TKp-PKQEDVDIKQKILTDLKHLEKVVASKIAEIEADLEKL 126 Vibrio vulnificus YJ016
WP_014293624  82 QALLELHWLlgseVK--TDEATADTKQQLLADLEHMERVMQDKLDELRRQIEAL 133 Oceanimonas sp. GK1
WP_011978562  78 RAMEELEQI----VG--RQHETKATKEDLIKELEHLEKVVNSKINEIKEKIDSM 125 Marinomonas sp. MWYL1
WP_015465739  80 NIIEELDTL----TL--QVKTKTDIKSELLEDIKHLETVFNAKINEIEEKIKNL 127 Psychromonas sp. CNPT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap