Conserved Protein Domain Family
DUF3450

?
pfam11932: DUF3450 
Protein of unknown function (DUF3450)
This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are about 260 amino acids in length.
Statistics
?
PSSM-Id: 378764
View PSSM: pfam11932
Aligned: 72 rows
Threshold Bit Score: 142.367
Threshold Setting Gi: 293615133
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
dbos:1099484000100_PB2503_06452   4 SLALMGSAALCslalmtpaSAQFRAALNESKAAVDEGARSQQRVEELDQQATELLGDYRAAQKQAELLRRFNASRRREVE 83  Parvularcula bermudensis HTCC2503...
jgi:Dacet_0965                    7 VILLLLSASAY--------AETAGEILNTQKSIHSIKSKFYEEKEEWDKDKLNMEERYGALTRAVEAREAYLLNLKKINE 78  Denitrovibrio acetiphilus DSM 12809...
jgi:Nhal_3839                    18 VAGLLIWSGA-----------QADSLDNLAEELIRMRSEVEELQSQLDLEKEKYKNRMEVLSSQLAELSVENRRLSLSVE 86  Nitrosococcus halophilus Nc 4...
jgi:Nit79A3_1090                 30 VLLLLVTSVA-----------KGSSLENLAKALAKIRGEVETLQTQLDTEKDKHSSRMSALTSQLADLSVEERRQKMSIE 98  Nitrosomonas sp. Is79A3...
Q12M86                           13 GCTLCVAMPSW--------GQATANLDELTAQWLALDKSTQKLKSDWQLEKQQLKLRIGLLTQENSQLSAQIKQDQHNQD 84  Shewanella denitrificans OS217...
Q21GV8                           15 AALLLWAGSSQ--------AQTPDTVDRLTQQWLATEQQASALMSEWQLQQPMLEQRKALLQAEKEQLLAILKQSDAGQS 86  Saccharophagus degradans 2-40...
CASKLGSI:C427_2155               11 CLPLMAKSNGL-------------EIGKLAKQWVQLAQQNNQVKQQWRLRKPILQQQLQLLKAEKNRLTALLNQDDDVSD 77  Paraglaciecola psychrophila 170...
Q6AIX6                            7 LLVLMFWPLNLm------aAPSPDAVQAELERSVQRASATGKKTDAWQRQRQGILEEIQDAELKLEWARFQLQKRERWLL 80  Desulfotalea psychrophila...
jgi:Deba_2297                    10 IACLVAAGAAWaq-----sGPTAQQVGQDAKTAVDTRVGTQKAYDSWADERAKLRDDAETLQRELELAERQCKKSEAYLA 84  Desulfarculus baarsii DSM 2075...
Q3A6A2                           21 LVGLIPWTAA---------AETATQVKHTAERAVAVDAATQQAVEAWEAEKQTLLANIDRAHTRLQNIDWQRRKATDYSA 91  Pelobacter carbinolicus DSM 2380...
dbos:1099484000100_PB2503_06452  84 NQLREIEGLEQDVENIEGLQQATLPLLEDMMNTLAAFVEADTPFLQTERMERIERLREVMADSTQTAASRYNLIVEAYQI 163 Parvularcula bermudensis HTCC2503...
jgi:Dacet_0965                   79 ELAGELERKKTKMTSAKGVERRLDILLADMLMKLQRHIESTSGYTYDQRMQSLEEMMRLNADPEVKPQEKIRRVAELFMV 158 Denitrovibrio acetiphilus DSM 12809...
jgi:Nhal_3839                    87 QLHQTFEEHKQQLSQRQAGETELLPVMLKAVDYLQDYVRTGLPFKVEGRLTELEQLHTQLETGVLDPKKSANRIWAFIED 166 Nitrosococcus halophilus Nc 4...
jgi:Nit79A3_1090                 99 KLQHSIEKMTVNAKKAEQSGESLKPVLLAMLADYRQHIQTGFPFKPEDRIRALGDLENNVVNQLIDPNKAVNQAWSLIED 178 Nitrosomonas sp. Is79A3...
Q12M86                           85 EVSQQRQALLNAQTDIEQVVDAYRLAFPSMLSRIQQLLAGLPPYLEHQLADDLNKLNE-----KSELTAQYQGIANIAKQ 159 Shewanella denitrificans OS217...
Q21GV8                           87 SVDTRRSELLAEQSNLEKQQQQLTQSLEQLVARQHSLTELLPPPLASAWQKESATLSE-----SPEASQLLQVALAQLGQ 161 Saccharophagus degradans 2-40...
CASKLGSI:C427_2155               78 EMQQQRFSLLKQQTQFEATQDSLSVILDKTQQRLITLYPQLPPPLKTRWDTEIALLKTFKDN-----SERLEKQLFLLDS 152 Paraglaciecola psychrophila 170...
Q6AIX6                           81 AEKKNSAILAANIASAQETRDKLAPFLEVLYADLEEEVETDLPFHGDERRRRLAFIREALDDQGASLSDKLGKLLQAMQV 160 Desulfotalea psychrophila...
jgi:Deba_2297                    85 GQKAKVADLEGRLREIERIRAELEPYLDETMERLDKFVAADMPFLAKERHDRLASLKAKLDDYDASLALKASRVLEALYI 164 Desulfarculus baarsii DSM 2075...
Q3A6A2                           92 TLNRKIEALKLRAAEMEKINVELLPLLDQMLDRLQTFVAADLPWQQAERRRKLAHTRQLLNDYDTGLLPKTRAVLETLAR 171 Pelobacter carbinolicus DSM 2380...
dbos:1099484000100_PB2503_06452 164 ENEYGRTLDSYKGVVTTdAGEELQVEFLRIGRLALIYKTADNSLLRIYDPKVG-SFV--DL-DRSFMEDVVRGIRIANEQ 239 Parvularcula bermudensis HTCC2503...
jgi:Dacet_0965                  159 EADLARFAEVYEEKVTL-NGKEISGYLLRLGALGQFFTTPDKRRAAVYDPAQN-GFT--EI-DQRYAQEIMKAARIIEKK 233 Denitrovibrio acetiphilus DSM 12809...
jgi:Nhal_3839                   167 EVRLSKENGIYRQTIQL-DGENKLAEVAKIGMMLLFFQTEDSRVGMARQEQD--HWRfvVVdTEQDRKNIVQLFDSLKKQ 243 Nitrosococcus halophilus Nc 4...
jgi:Nit79A3_1090                179 EIRLSKENGIYQQVIFL-DGENVLVDIAKLGTVFLFFQTRDNRFGMAKRLSDG-GWKyeTVdDTNDIERIKNLFDSLKKQ 256 Nitrosomonas sp. Is79A3...
Q12M86                          160 VAKAENLIVVKQGMITL-NGTPLLTEQLYLGHRHAWFITQDNATAGIGYPSAD-GWQwqPV--DAEHDSIRQAIISAKNQ 235 Shewanella denitrificans OS217...
Q21GV8                          162 LADFDNRLSVHEAPIQQpDGGELLVKQLYLGVGMAWFSSADGEFAGWGQASDA-GWEw-HIdTSANAKEIHKAIAIYEKR 239 Saccharophagus degradans 2-40...
CASKLGSI:C427_2155              153 VAGYNQRIAVHQANMTFdDGQEVQVKQIYLGAYLGWYVSQNGQYWGSGKSTPN-GWQwqHQsKQITPQKLLDLMAATQDF 231 Paraglaciecola psychrophila 170...
Q6AIX6                          161 ELDYGYSTDVVETIVAD-GGEQVQATIFRLGRLALFRLLDRGTRAQRFDDKAG-QWQ--DL-PEGSASEIAKAVEVARKK 235 Desulfotalea psychrophila...
jgi:Deba_2297                   165 EAQYGGTVEVKEEEMTL-EGSAKGVRVLRLGRLGLYALGLDGRTAWRFDRPSG-RWVr----EDDFARELGQAADMAART 238 Desulfarculus baarsii DSM 2075...
Q3A6A2                          172 EADLGHTVAVREAEIAV-DGQPRQVRLLQVGRLGLYALTMDGRQAYAWDGELRsFWA-----LDEGGRDIGQAMQMAEGT 245 Pelobacter carbinolicus DSM 2380...
dbos:1099484000100_PB2503_06452 240 LPPDLMTIPVS 250 Parvularcula bermudensis HTCC2503
jgi:Dacet_0965                  234 AAPELVHLPVg 244 Denitrovibrio acetiphilus DSM 12809
jgi:Nhal_3839                   244 IRQGYFELPnp 254 Nitrosococcus halophilus Nc 4
jgi:Nit79A3_1090                257 IRQGYFELPnp 267 Nitrosomonas sp. Is79A3
Q12M86                          236 VPGELLHLPVN 246 Shewanella denitrificans OS217
Q21GV8                          240 QQADLVKLPIQ 250 Saccharophagus degradans 2-40
CASKLGSI:C427_2155              232 SHAELIRLPIn 242 Paraglaciecola psychrophila 170
Q6AIX6                          236 RVTTVLSLPLA 246 Desulfotalea psychrophila
jgi:Deba_2297                   239 RVISLVELPVg 249 Desulfarculus baarsii DSM 2075
Q3A6A2                          246 RILALSRLPVG 256 Pelobacter carbinolicus DSM 2380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap