3BQ9


Conserved Protein Domain Family
DUF3412

?
pfam11892: DUF3412 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3412)
This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 120 amino acids in length. This domain is found associated with pfam03641.
Statistics
?
Aligned: 77 rows
Threshold Bit Score: 170.773
Threshold Setting Gi: 242122602
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BQ9_A         330 MAAVKQYRRDSGDAYYFNWTLKINEEFQRPFSPTHENVAALNLHPDQPKERLAADLRRAFSAIVAGNVKDEGIRQIRKNG 409 Idiomarina ba...
jgi:Pat9b_3110 385 MPQVKEYRRETGDAYSFNWSIRIVPDLQLPFLPTHENMANLNLYTNQPAEKLAADLRRAFSGIVAGNVKEVGIREIREKG 464 Pantoea sp. A...
CBJ79721       333 MPQVKEHRRSTGDAYSFNWSLKISHDLQHPFEPFHSNMANLNLHPNQPSEKLASALRCAFSGIVAGNVKEAGIHAIEKDG 412 Xenorhabdus b...
Q7N8Q8         333 MPLVRDNRHSTGDAYSFNWSMKINYDLQQPFEPSHENMANLNLYPDQSPEKLAASLRRAFSGIVAGNVKEMGIQSIEQQG 412 Photorhabdus ...
CCH:MU9_923    333 MPEVKDNRRSTGDAYSFNWSIKIAGDLQHPFEPTHENMAALNLYRNQEPEKLAADLRRAFSGIVAGNVKENGMQAIAQHG 412 Morganella mo...
ACQ66926       338 MKKVKENRCYTKDAYSFNWSIHINEKQQHPFNPTHQNMADLNLKCDQAPEALAAALRCAFSGIVAGNVKEKAIQAVKTQG 417 Candidatus Ha...
OTP83871       336 VKHVKSSRLKTGDAYGFNWLLKIDESLQRPFEPLHENMAALNLHRNQPVELLAADLRRAFSGIVAGNVKEFGMKQIAEHG 415 Gilliamella a...
Q7CH10         333 MPLVKEYRRNTGDAYSFNWSIRIEPDLQHPFEPNHENMANLDLSHNQPPEKLAAALRRAFSGIVAGNVKEVGIQAIEAHG 412 Yersinia pestis
CBL47036       336 aERVYKHRRRCKDSFYFNWQIHLPKSLQFPFQPNHASMQKLNLTRDQPAYELAANLRRAFSGIVAGNVKDQGLALIKEHG 415 gamma proteob...
CCX91247       336 ndSVLDHRTITHDSYCFNWTLHIPLELQIASPITHEFMANLDLRRDQEPWKLACNLRSAFSGIVTGNVKENGIKLVAQKG 415 Succinatimona...
3BQ9_A         410 VFTIHGEQSLMKRLDELLRAFVEQGRMKLP-GSVYNPCYKVI 450 Idiomarina baltica OS145
jgi:Pat9b_3110 465 PYKLHGDPDIMHRMDELLQGFVAQHRMKLP-GTAYIPCYEII 505 Pantoea sp. At-9b
CBJ79721       413 AFKIHGDVDIMRCMDELLKDFVRQDRMKLPgGTAYEPCYEII 454 Xenorhabdus bovienii SS-2004
Q7N8Q8         413 PFKIHGDVKIMRHMDKLLKDFVEQHRMKLPgGTAYEPCYEII 454 Photorhabdus laumondii subsp. laumondii
CCH:MU9_923    413 PFKIHGEEAIMQRMDVMLRGFVEQHRMKLPgGTAYEPCYEII 454 Morganella morganii subsp. morganii KT
ACQ66926       418 PFKLKGDPDMLQQLAQLLENFIHQGRMKLt-GTAYQPCYEId 458 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon ...
OTP83871       416 RYKLQGDPEIMKQLDNLLRSFVKQDRMKLPgGTAYQPCYEIC 457 Gilliamella apicola
Q7CH10         413 PFKLHGDPQLMKQMDRLLQDFIAQHRMKLP-GSVYTPCYEIC 453 Yersinia pestis
CBL47036       416 PFQLHGDPSIMALMDELLQTFIQQNRMKLg-GNSYNPCYQIV 456 gamma proteobacterium HdN1
CCX91247       416 PFKLHGDKDIIKSLDGLLRSYIDQGRVLLs-QKEYVPCYELV 456 Succinatimonas sp. CAG:777
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap