Conserved Protein Domain Family
DUF3347

?
pfam11827: DUF3347 
Protein of unknown function (DUF3347)
This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 169 to 570 amino acids in length.
Statistics
?
PSSM-Id: 314659
View PSSM: pfam11827
Aligned: 64 rows
Threshold Bit Score: 151.348
Threshold Setting Gi: 917167774
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014022531  20 VACKNENKTNRNSTPE-MQSHE-------EMDVESNTGQSSKEVlngdtdtgsgmhaqhkslkdnfahqdiiilenpfqp 91  Cyclobacterium ...
WP_013688460 105 AGCCQYERVKKTAIVS-TAVIE-------DHSMHNQENVVETKQ------------------------------------ 140 Fluviicola taff...
WP_013666069  20 aSCNGESQSSKTENDH-SQHQT-------VAERDNPQAPK---------------------------------------- 51  Sphingobacteriu...
WP_015807870  14 VSCTNTEKKVAGNSDT-TSGVV-------D---------TIANH------------------------------------ 40  Pedobacter hepa...
WP_049792098  10 TSCDDNKGNQEMEMME-NMLLQ-------ENSGMMGNDNTSNSD------------------------------------ 45  Gramella forsetii
WP_014680801  17 AACDGQAKKAENHEGHdHSSHD-------GHSHEATVQNTSPTG------------------------------------ 53  Solitalea canad...
WP_014200870  18 TACNNAAEGTHNEAGH-EMHEHeghehsgDMEHHEADTETTMAK------------------------------------ 60  Owenweeksia hon...
WP_041515903 105 PQCCQYERTNMAAPIK-KSEMD-------MGKMDHsqh------------------------------------------ 134 Flavobacterium ...
WP_015808856  18 AACGNTQKPAEADPHA-GHNHA-------QGEGH---------T------------------------------------ 44  Pedobacter hepa...
WP_008463745  18 IACGNGENNKKEVQQN-NK------------------------A------------------------------------ 36  Flavobacterium
WP_014022531  92 EKS---------TKDDLQE------VVQAYLLLKDAFVKGDLKRIDDASATMEQKVADVVANSLKEDGLVAWDQHSKLYT 156 Cyclobacterium ...
WP_013688460 141 EVN---------Q---LKT------IFESYFALKDALVKSDGKLVSTLAKDVLANINSVKMEKLSSEEHTVWMKVMSSLK 202 Fluviicola taff...
WP_013666069  52 --T---------KNEALDA------LYPHYLALQEALVAGDISKAKEAGLLVEEAGKHVD--------------GAKDLQ 100 Sphingobacteriu...
WP_015807870  41 IEL---------KDNKVQA------IYNGYIALKDALVAAKFEDAQKTAAVLKTDLAAYK--------------GCESTA 91  Pedobacter hepa...
WP_049792098  46 G-V---------QDSEFAS------IMSSYIAIKYALIADDASRAQEEAEKLVKK--------------------SPGLE 89  Gramella forsetii
WP_014680801  54 PSF---------NSDALNN------VYGHYIHLKNNLVASNEAE---------------SKTAAAALKTAIADLKDAEVL 103 Solitalea canad...
WP_014200870  61 TSL---------DAAMVTS------ITTDYLAVKDALVNDDAEGAKAAAAKMQSVLTGTE------------DELCKKLL 113 Owenweeksia hon...
WP_041515903 135 ---------taaVPADAQEnspfkaIFDSYFDVKDALVKTDAKTAALKSKELLTAINAIKMENLKPKEHTAWMNAMKSLA 205 Flavobacterium ...
WP_015808856  45 APTeqatagvsiKDDKLNA------VYQHYIHLSTALVNEDVAEAKVAASAIELGAKEL--------------TGGTALV 104 Pedobacter hepa...
WP_008463745  37 SVPilkdpairiNDDILNA------IYSHYAHLTVALAQDNVAEAKLAANAIEAGAREI--------------SSNSNLA 96  Flavobacterium
WP_014022531 157 GKLKELRHVTSLEEKRSYFSHISEVVYCTVKSFDLKDKmALYAAFCPMAFDGKGAYWISENKEIRNPYNGDKMLKCGKIE 236 Cyclobacterium ...
WP_013688460 203 SNTEKIAATTIIEKQRVVFMDLSANFYALLKVSKQDYS--IYYQNCPMYNDGKGANWLSKENAVKNPYYGSQMLTCGKTv 280 Fluviicola taff...
WP_013666069 101 EAASQVLSAENIDSQRDAFSSLSNALIELIKTHGVATG-EFYVAHCPMAFNDKGANWLSPTKSIKNPYFGDKMLNCGSVE 179 Sphingobacteriu...
WP_015807870  92 LTAEKIAVAKDIKNQRALFTSLSEDVIALFKHADLIKG-SIFVQHCPMANNGVGGDWLASEKKIQNPYYGDEMMDCGRVv 170 Pedobacter hepa...
WP_049792098  90 RSAKAIAETDNIEKQREYFSEMSTVLYQMAKNNDID-G-SVYWNHCPMALNGQGANWLSQNEKIQNPYMGQKMPGCGSVQ 167 Gramella forsetii
WP_014680801 104 KAAEQTAAATNLEGIRASFNDLSKQIERVIKSTGVKSG-EVYVEFCPMANNDKGGFWLSNSSEIQNPYYGDQMMKCGSVE 182 Solitalea canad...
WP_014200870 114 FDAEHISGTTEIGHQRDHFEVLTKNVVALNTQVKTGQD--LYIQHCPMAFDGKGADWVSNSKDVFNPYFGEKMLKCGRVQ 191 Owenweeksia hon...
WP_041515903 206 SDATNISENQDVKKQRESFKSLSKNTYDLIKTADQPQP--VYYNHCPMVD----ANWLSKESGIKNPYYGSQMLSCGSTi 279 Flavobacterium ...
WP_015808856 105 TLASKITTGADIEAQRTVFSDLSNDFIARVKASGLNSG-EVYVEYCPMALHDKGASWLSNKKEIRNPYFGESMMTCGEVK 183 Pedobacter hepa...
WP_008463745  97 ASATAIVSAPDIDKQRAAYSNLSNEMVSLVKKAGMAEA-ELYLEYCPMAFDNKGAVWISSTKEVRNPYFGEKMLKCGEVK 175 Flavobacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap