1HO8


Conserved Protein Domain Family
V-ATPase_H_C

?
pfam11698: V-ATPase_H_C 
Click on image for an interactive view with Cn3D
V-ATPase subunit H
The yeast Saccharomyces cerevisiae vacuolar H+-ATPase (V-ATPase) is a multisubunit complex responsible for acidifying organelles. It functions as an ATP dependent proton pump that transports protons across a lipid bilayer. This domain corresponds to the C terminal domain of the H subunit of V-ATPase. The N-terminal domain is required for the activation of the complex whereas the C-terminal domain is required for coupling ATP hydrolysis to proton translocation.
Statistics
?
PSSM-Id: 338065
View PSSM: pfam11698
Aligned: 135 rows
Threshold Bit Score: 106.399
Threshold Setting Gi: 667632061
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HO8_A       354 ELTSFDEYVAELDSKLLCWSPPHVdNGFWSDNIDEF-KKDNYK-----IFRQLIELL-Q---AKvrngdvnakqE--KII 421 baker's yeast
Q8SRF3       259 kkfcirNYLNELFSGRFEDSEYHHkKDFWSTNLDMLiKNK-VE-----IVKVLKKYL------K----------SnnPSW 316 Encephalitozoon...
XP_006956841  29 SISNWDEYSSELESGLLRWSPVHTdEDFWKNQSGAL-LKDNNW-----GLNRLFSLL-D---SE----------D--QQI 86  Wallemia sebi C...
XP_001305213 318 KLSLWDKYVREVKSGKLKNTISHSsELFWKANVERF-GENNFA-----VLIALRDLL-K---SD----------D--EET 375 Trichomonas vag...
ELQ75169     284 KTSSFQNYLRELFSGKLENTPYHFsDVFWSMNMNSL-IEYKIE-----IIRALKKYL-K---SG----------C--TQH 341 Trachipleistoph...
XP_001707099 408 KVTTWETYLAELKSDLLGNTPVHTsEAFWKANSHRL-LDNSAY-----ALNRLEQIG-TkayKS----------D--TNS 468 Giardia lamblia...
EJW04504     269 KSTCIDTYLNEMFSGCLEESPYHYsEQFWEANSAKL-LENKEE-----ILKAIKKYL-N---SK----------N--PQY 326 Edhazardia aedi...
EPR78963     333 NTSSINNYISELFSGRLEDAPYHYdNSFWENNIHVL-LNNGNYstiqgIFKALKKYLyR---TD----------D--IRS 396 Spraguea lophii...
XP_002995051 254 neyTIENYVTDLFKGILEDHDYHYdEVFWSSGYPRI-SKNIVD-----IIKLLKKYL-K---SH----------N--SSW 311 Nosema ceranae ...
XP_008073313 338 NVSSVENYLKELYSGHLEPTLYHFeESFWNVNLTKL-QIKKHE-----IIKAIRLYL-K---RG----------E--RQN 395 Vavraia culicis...
1HO8_A       422 IQVALNDITHVVELLPESIDVLDKT-GGKADIMELL-NHSDSRVKYEALKATQAIIGYTF 479 baker's yeast
Q8SRF3       317 ICLACSDIFQLVRASPEINAVLSKY-QVREILFNLI-NSDNDDIKFHAIQALYTCISSEW 374 Encephalitozoon cuniculi
XP_006956841  87 LHITLYDISQCLKFIHHAKTYVDS--SSKQKIMELL-QHPDPKIKYQALITTQLLISQPW 143 Wallemia sebi CBS 633.66
XP_001305213 376 VTVACHDIGEYVHRHPLGRIKVEEI-HAKEMIMELL-INKNQNIVSQAlrttqllllrnn 433 Trichomonas vaginalis G3
ELQ75169     342 KCVAANDLYRFVKACPEIVRIVEKF-DLKTELFKLC-ESTNDDLRFYALQSLSVCIFQEW 399 Trachipleistophora hominis
XP_001707099 469 LLVCLNDIGMFCISYSNGRNVVAQMpNIKAFVMSCL-QHEAETVRDAAIVTLSKVLVDNW 527 Giardia lamblia ATCC 50803
EJW04504     327 ICIASNDLYMFTKMSPNISHLIAEY-DIKSDLFDLAkNSDNPDIRFHAIQALASCIFLDW 385 Edhazardia aedis USNM 41457
EPR78963     397 VCVAANDLYRIIKIAPEIYPVVDKL-NIKQTLVKLS-DNNNEDIRFHALQTLSTCIFTEW 454 Spraguea lophii 42_110
XP_002995051 312 ICLACNDIYMLVKSNPQVHNLISKH-KVRDVLYELT-KSENDEIRFKAIQALYASIFSEW 369 Nosema ceranae BRL01
XP_008073313 396 VVMALNDLLMFHNVDASIGRLIENY-GVKDQLIELC-GSNDNEIQFLALQAflsvlnqql 453 Vavraia culicis subsp. floridensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap