5YNY


Conserved Protein Domain Family
Blo-t-5

?
pfam11642: Blo-t-5 
Click on image for an interactive view with Cn3D
Mite allergen Blo t 5
This family of proteins is Blo t 5, an allergen protein from Blomia tropicalis mites. This protein shoes strong reactivity with IgE in asthmatic and rhinitis patients. The structure of the protein contains three alpha helices which form a coiled-coil.
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 145.252
Threshold Setting Gi: 111120428
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YNY_A    10 GLVPRGSEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKR 89  American house dust...
Q1M2M7   138 GEVSRTDKDELREEFDRLLVAVTMDHFHKLEQAMFNLSNQVIEFENTKSKTMKAEIIREISLALDFIAIAKGHIERELQR 217 Glycyphagus domesticus
Q1M2N1    54 VDVAIPNPDEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFIDSAKGHFERELKR 133 Lepidoglyphus destr...
ABO84969  18 FIVDVDTEDKWRGAFDRMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKR 97  American house dust...
Q2L7C5    20 FIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQYKELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKR 99  European house dust...
Q1M2M6    16 AAPLAPNPDDFRNEYDRLLVITIQEKLADTEHFLARLSHQLVELNKSKSKAVKDQILLEIDFSLNFLAGANGHLERELKR 95  Glycyphagus domesticus
APU87555  17 AQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKR 96  Blomia tropicalis
ABH06348  14 ACALPVSNDNFRHEFDHMIINTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKR 93  Blomia tropicalis
5YNY_A    90 TDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKSD 127 American house dust mite
Q1M2M7   218 PDLNLLEKYNFEATLATGVVLTRDLTTLEKHVKSIEAQ 255 Glycyphagus domesticus
Q1M2N1   134 ADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIETK 171 Lepidoglyphus destructor
ABO84969  98 TDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKSD 135 American house dust mite
Q2L7C5   100 TDLNMFERYNYEFALESIKLLIKKLDELAKKVKAVNPD 137 European house dust mite
Q1M2M6    96 TDLNFLEKFNFEELLATGTVLYKDLEETQKHVKAVETK 133 Glycyphagus domesticus
APU87555  97 TDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ 134 Blomia tropicalis
ABH06348  94 TDLDLLEKFNFEAALATGDLLLKDLKALQKRVQ--DSE 129 Blomia tropicalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap