2JMH


Conserved Protein Domain Family
Blo-t-5

?
pfam11642: Blo-t-5 
Click on image for an interactive view with Cn3D
Mite allergen Blo t 5
This family of proteins is Blo t 5, an allergen protein from Blomia tropicalis mites. This protein shoes strong reactivity with IgE in asthmatic and rhinitis patients. The structure of the protein contains three alpha helices which form a coiled-coil.
Statistics
?
PSSM-Id: 288489
View PSSM: pfam11642
Aligned: 8 rows
Threshold Bit Score: 147.957
Threshold Setting Gi: 111120428
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JMH_A     1 GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELK 80  Blomia tropicalis
Q1M2M7   137 EGEVSRTDKDELREEFDRLLVAVTMDHFHKLEQAMFNLSNQVIEFENTKSKTMKAEIIREISLALDFIAIAKGHIERELQ 216 Glycyphagus domesticus
Q1M2N1    53 EVDVAIPNPDEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFIDSAKGHFERELK 132 Lepidoglyphus destr...
Q2L7C5    19 GFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQYKELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAK 98  European house dust...
O96870    16 LAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELK 95  Blomia tropicalis
ABH06348  13 VACALPVSNDNFRHEFDHMIINTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELK 92  Blomia tropicalis
ABO84969  17 GFIVDVDTEDKWRGAFDRMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAK 96  American house dust...
Q1M2M6    15 VAAPLAPNPDDFRNEYDRLLVITIQEKLADTEHFLARLSHQLVELNKSKSKAVKDQILLEIDFSLNFLAGANGHLERELK 94  Glycyphagus domesticus
2JMH_A    81 RTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ 119 Blomia tropicalis
Q1M2M7   217 RPDLNLLEKYNFEATLATGVVLTRDLTTLEKHVKSIEAQ 255 Glycyphagus domesticus
Q1M2N1   133 RADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIETK 171 Lepidoglyphus destructor
Q2L7C5    99 RTDLNMFERYNYEFALESIKLLIKKLDELAKKVKAVNPD 137 European house dust mite
O96870    96 RTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ 134 Blomia tropicalis
ABH06348  93 RTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQ--DSE 129 Blomia tropicalis
ABO84969  97 RTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKSD 135 American house dust mite
Q1M2M6    95 RTDLNFLEKFNFEELLATGTVLYKDLEETQKHVKAVETK 133 Glycyphagus domesticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap