Conserved Protein Domain Family
Limkain-b1

?
pfam11608: Limkain-b1 
Limkain b1
This family of proteins represents Limkain b1, which is a novel human autoantigen, localized to a subset of ABCD3 and PXF marked peroxisomes. Limkain b1 may be a relatively common target of human autoantibodies reactive to cytoplasmic vesicle-like structures.
Statistics
?
PSSM-Id: 288461
View PSSM: pfam11608
Aligned: 3 rows
Threshold Bit Score: 146.621
Threshold Setting Gi: 313230049
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAF95258  100 SFSLLFVRNLPVNCDKsLQNAVKHRLRRLSDNCGGKVLGISQGTAVLRFSSPEAASRACKRMENEDVYGHRISLSSSpgp 179  spotted green puf...
CBY07753  289 CESMVVVSNLPTSQHL-PKSAIRNRLSQLFENTGGRVQHVFGKSASVSFRNQDMARRALKRLDGEDVFGNKITIREK--- 364  Oikopleura dioica
CAJ83560  333 CQTLLYVYNLPTNRD---AKSISNRLRRLSDNCGGKVMSISGTSAILRFANQESAERAQKRMENEDVFGNRITVSFTprn 409  western clawed frog
CAF95258  180 RDDASPEPE 188  spotted green pufferfish
CBY07753  365 AIFNDEEHR 373  Oikopleura dioica
CAJ83560  410 KEVNETKNS 418  western clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap