Conserved Protein Domain Family
AviRa

?
pfam11599: AviRa 
RRNA methyltransferase AviRa
This family of proteins represents the methyltransferase AviRa from Streptomyces viridochromogenes. This protein mediates the resistance to the antibiotic avilamycin. AviRa methylates a specific guanine base within the peptidyl-transferase loop of the 23S ribosomal RNA.
Statistics
?
PSSM-Id: 314478
View PSSM: pfam11599
Aligned: 2 rows
Threshold Bit Score: 504.207
Threshold Setting Gi: 501155582
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012200180   1 MEYKYTKNDNYEDFASGRVLYHVGGEPTFPVRLALEIYERCLQYSIKKAEISLYDCCCGGAYMLSILGLLKSNTIANLYG 80  Clostridium phy...
2_pfamImport   1 MEYKYTKNDNYEDFASGRVLYHVGGEPTFPVRLALEIYERCLQYSIKKAEISLYDCCCGGAYMLSILGLLKSNTIANLYG 80 
WP_012200180  81 SDINSESIQLANDNLGLLTKSGINKRRDELKALYQTYKKASHIDALHSIDRIEELLTREIKTYLFKGNVLEVCDLPFTPD 160 Clostridium phy...
2_pfamImport  81 SDINSESIQLANDNLGLLTKSGINKRRDELKALYQTYKKASHIDALHSIDRIEELLTREIKTYLFKGNVLEVCDLPFTPD 160
WP_012200180 161 IIITDVPYGNMVEWEEGSGGINQMMNALSAVCGSDTIICVCMDKKQKIHNDIFQRLERQLVGKRKFEIYKKKASEIA 237 Clostridium phytof...
2_pfamImport 161 IIITDVPYGNMVEWEEGSGGINQMMNALSAVCGSDTIICVCMDKKQKIHNDIFQRLERQLVGKRKFEIYKKKASEIA 237
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap