Conserved Protein Domain Family
ADIP

?
pfam11559: ADIP 
Afadin- and alpha -actinin-Binding
This family is found in mammals where it is localized at cell-cell adherens junctions, and in Sch. pombe and other fungi where it anchors spindle-pole bodies to spindle microtubules. It is a coiled-coil structure, and in pombe, it is required for anchoring the minus end of spindle microtubules to the centrosome equivalent, the spindle-pole body. The name ADIP derives from the family being composed of Afadin- and alpha -Actinin-Binding Proteins localized at Cell-Cell Adherens Junctions.
Statistics
?
PSSM-Id: 402936
View PSSM: pfam11559
Aligned: 19 rows
Threshold Bit Score: 105.474
Threshold Setting Gi: 758985980
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001384912   14 RHASDLINSMLLSRAYTDQKIQFTTIdwddlirdqvldneevpkinelkvtEKLYENDRATINIIHSLLVALDRNRGQQK 93   Scheffersomyc...
EDK38180       10 RNAADLINSTLLSKGYVDEKLYFNTIdwshlssdq-------pqqvslettDVVYNNDKNIINIVFSLLKSIERNKAQNQ 82   Meyerozyma gu...
Q6C1M1          2 EAAAEFINHTLVSKGYLLSDRLKFATvsk-------------------tplENVEENDMLVINTIYSLLQSLEKDSKAEE 62   Yarrowia lipo...
Q9P6R4         14 EESLLYINKSLFSKGVIQAEKLRLSH---------------------------DIRDNCNIVNIIYRLLRATDEERLEKE 66   Schizosacchar...
Q0U9Q5          7 KTASAYINNLLLARGLLRDGKAIEFAhps-------------------rgaGGKEQTMAHIINVVHDLILKRDRDQEYRE 67   Parastagonosp...
Q2HGV6          8 RTASLYINNQLLSRGLLRDGNGIDFAqpg-------------------dtdTAVAETMSRIMAV---------RDAEHRE 59   Chaetomium gl...
XP_958669       8 RTASIYINNQLLSRGLLRDGDTIDFAypg-------------------dndDELAHTMGRIMGVVNDLILRRDRDAETRE 68   Neurospora cr...
Q0CWV7          7 QAASTYINNVLLARGLLKNGRPIDFAepe-------------------neeGGTGATMGRIINLVNDLVLRRDREAEHRE 67   Aspergillus t...
Q4WAP1          7 QAASTYINNVLLARGLVKSGRPIDFAqpe-------------------nddGGVEGTMARIINLINDLVLRRDREAEHRE 67   Aspergillus f...
Q5KLN4         35 SAELTTINSQLMSHGWAKRPLNLDAL---------------------------SQKDYNEVVAVLFELMGASVSNLNMLE 87   Cryptococcus ...
XP_001384912   94 LSNQTIHQKDATIESLKSRISLLETQLAQSENKVDkLVHFDQNELNKRITDLSRHNKIQAQDLNKLRNWAGDIKTKYRVE 173  Scheffersomyc...
EDK38180       83 AFNRQLSQKDATIANLNKKIDQLTTQVSQQQMQISkLYQFDHTQLNKKVQSLTQINKLQSQDLNRLNNWCKDIKTKYGVE 162  Meyerozyma gu...
Q6C1M1         63 NRLRRVADLEHDNDRLRNEIRALHRKNHDLHTRLA-HEENALQNAKREIARLEAAAKNERGSLTRAKMAVDRFKQQSMVE 141  Yarrowia lipo...
Q9P6R4         67 SLLDAIKNNEYEKQRDNNTIKRLKNELELYQNECQ-LQLNKVRTLERDQAELITQNKGLKDVNAKNELTLKALKNQLSVS 145  Schizosacchar...
Q0U9Q5         68 SMAETLRTLRSESTRQTIALEKLQTRNEDLARQVS-LAQSQERSARAALRTAESSARSLRDEMLRLKTTVQQIRTSCAND 146  Parastagonosp...
Q2HGV6         60 SLSATLRTLRAESLRQANDIQRLQEKYSDAQRKVG-LSEAAEAALRTNLKTAEGTVHRLKEEAARTKTLVAQTRASCANE 138  Chaetomium gl...
XP_958669      69 SLSQTLRSLRAESLRQSTDIVRLSDKLTDSARKTA-LAEQETAHARAQLKAAEQTVARLKEEAARQKSLVQQTRNACANE 147  Neurospora cr...
Q0CWV7         68 NLATTIRALRTEDSQKTVEIEKLKAKASELTRALA-LAEAQERSLKSNVAHTDATIRGLKEQVQRMKTTIQQVRAQCAND 146  Aspergillus t...
Q4WAP1         68 NLATTIRTLRAEDSQKMLEIEKLKTKTSELARSLA-LAEAQERALKTNLSSTEATIRGLKEQIQRMKANVQQIRAQCAND 146  Aspergillus f...
Q5KLN4         88 TLNGRHRTLEYEYERLQKTTNSLKTSNARLESEVA-GWKSKCADIEKRLVLEEIKTKELREENSRGRKALETVRVAATHE 166  Cryptococcus ...
XP_001384912  174 LKKKTLEISELKNKLLE 190  Scheffersomyces stipitis CBS 6054
EDK38180      163 IRRRNIEITSLKSKLLE 179  Meyerozyma guilliermondii ATCC 6260
Q6C1M1        142 MRKRDVRLERMRELARK 158  Yarrowia lipolytica
Q9P6R4        146 LRQHEQQMETLKGNYGL 162  Schizosaccharomyces pombe 972h-
Q0U9Q5        147 VRKRDVQIQKLKGHLTT 163  Parastagonospora nodorum SN15
Q2HGV6        139 VRKRDRQIEGLKKAVTE 155  Chaetomium globosum CBS 148.51
XP_958669     148 IRKRDRMIEGLKKAVAd 164  Neurospora crassa OR74A
Q0CWV7        147 IRKRDLEMQRLKSHLSD 163  Aspergillus terreus NIH2624
Q4WAP1        147 VRKRDLEMQKLKSHLAE 163  Aspergillus fumigatus
Q5KLN4        167 TKKVQMSLDKAHAQLAK 183  Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap