Conserved Protein Domain Family
ADIP

?
pfam11559: ADIP 
Afadin- and alpha -actinin-Binding
This family is found in mammals where it is localized at cell-cell adherens junctions, and in Sch. pombe and other fungi where it anchors spindle-pole bodies to spindle microtubules. It is a coiled-coil structure, and in pombe, it is required for anchoring the minus end of spindle microtubules to the centrosome equivalent, the spindle-pole body. The name ADIP derives from the family being composed of Afadin- and alpha -Actinin-Binding Proteins localized at Cell-Cell Adherens Junctions.
Statistics
?
Aligned: 19 rows
Threshold Bit Score: 105.092
Threshold Setting Gi: 757943775
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABN66883       14 RHASDLINSMLLSRAYTDQKIQFTTIdwddlirdqvldneevpkinelkvtEKLYENDRATINIIHSLLVALDRNRGQQK 93   Scheffersomyc...
XP_001486607   10 RNAADLINSTLLSKGYVDEKLYFNTIdwshllsdq-------pqqvslettDVVYNNDKNIINIVFSLLKSIERNKAQNQ 82   Meyerozyma gu...
Q6C1M1          2 EAAAEFINHTLVSKGYLLSDRLKFATvsk-------------------tplENVEENDMLVINTIYSLLQSLEKDSKAEE 62   Yarrowia lipo...
Q9P6R4         14 EESLLYINKSLFSKGVIQAEKLRLSH---------------------------DIRDNCNIVNIIYRLLRATDEERLEKE 66   Schizosacchar...
Q0U9Q5          7 KTASAYINNLLLARGLLRDGKAIEFAhps-------------------rgaGGKEQTMAHIINVVHDLILKRDRDQEYRE 67   Parastagonosp...
Q2HGV6          8 RTASLYINNQLLSRGLLRDGNGIDFAqpg-------------------dtdTAVAETMSRIMAV---------RDAEHRE 59   Chaetomium gl...
EAA29433        8 RTASIYINNQLLSRGLLRDGDTIDFAypg-------------------dndDELAHTMGRIMGVVNDLILRRDRDAETRE 68   Neurospora cr...
Q0CWV7          7 QAASTYINNVLLARGLLKNGRPIDFAepe-------------------neeGGTGATMGRIINLVNDLVLRRDREAEHRE 67   Aspergillus t...
Q4WAP1          7 QAASTYINNVLLARGLVKSGRPIDFAqpe-------------------nddGGVEGTMARIINLINDLVLRRDREAEHRE 67   Aspergillus f...
Q5KLN4         35 SAELTTINSQLMSHGWAKRPLNLDAL---------------------------SQKDYNEVVAVLFELMGASVSNLNMLE 87   Cryptococcus ...
ABN66883       94 LSNQTIHQKDATIESLKSRISLLETQLAQSENKVDkLVHFDQNELNKRITDLSRHNKIQAQDLNKLRNWAGDIKTKYRVE 173  Scheffersomyc...
XP_001486607   83 AFNRQLSQKDATIANLNKKIDQLTTQVSQQQMQISkLYQFDHTQLNKKVQSLTQINKLQSQDLNRLNNWCKDIKTKYGVE 162  Meyerozyma gu...
Q6C1M1         63 NRLRRVADLEHDNDRLRNEIRALHRKNHDLHTRLA-HEENALQNAKREIARLEAAAKNERGSLTRAKMAVDRFKQQSMVE 141  Yarrowia lipo...
Q9P6R4         67 SLLDAIKNNEYEKQRDNNTIKRLKNELELYQNECQ-LQLNKVRTLERDQAELITQNKGLKDVNAKNELTLKALKNQLSVS 145  Schizosacchar...
Q0U9Q5         68 SMAETLRTLRSESTRQTIALEKLQTRNEDLARQVS-LAQSQERSARAALRTAESSARSLRDEMLRLKTTVQQIRTSCAND 146  Parastagonosp...
Q2HGV6         60 SLSATLRTLRAESLRQANDIQRLQEKYSDAQRKVG-LSEAAEAALRTNLKTAEGTVHRLKEEAARTKTLVAQTRASCANE 138  Chaetomium gl...
EAA29433       69 SLSQTLRSLRAESLRQSTDIVRLSDKLTDSARKTA-LAEQETAHARAQLKAAEQTVARLKEEAARQKSLVQQTRNACANE 147  Neurospora cr...
Q0CWV7         68 NLATTIRALRTEDSQKTVEIEKLKAKASELTRALA-LAEAQERSLKSNVAHTDATIRGLKEQVQRMKTTIQQVRAQCAND 146  Aspergillus t...
Q4WAP1         68 NLATTIRTLRAEDSQKMLEIEKLKTKTSELARSLA-LAEAQERALKTNLSSTEATIRGLKEQIQRMKANVQQIRAQCAND 146  Aspergillus f...
Q5KLN4         88 TLNGRHRTLEYEYERLQKTTNSLKTSNARLESEVA-GWKSKCADIEKRLVLEEIKTKELREENSRGRKALETVRVAATHE 166  Cryptococcus ...
ABN66883      174 LKKKTLEISELKNKLLE 190  Scheffersomyces stipitis CBS 6054
XP_001486607  163 IRRRNIEITSLKSKLLE 179  Meyerozyma guilliermondii ATCC 6260
Q6C1M1        142 MRKRDVRLERMRELARK 158  Yarrowia lipolytica
Q9P6R4        146 LRQHEQQMETLKGNYGL 162  Schizosaccharomyces pombe 972h-
Q0U9Q5        147 VRKRDVQIQKLKGHLTT 163  Parastagonospora nodorum SN15
Q2HGV6        139 VRKRDRQIEGLKKAVTE 155  Chaetomium globosum CBS 148.51
EAA29433      148 IRKRDRMIEGLKKAVAd 164  Neurospora crassa OR74A
Q0CWV7        147 IRKRDLEMQRLKSHLSD 163  Aspergillus terreus NIH2624
Q4WAP1        147 VRKRDLEMQKLKSHLAE 163  Aspergillus fumigatus
Q5KLN4        167 TKKVQMSLDKAHAQLAK 183  Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap