Conserved Protein Domain Family
ADIP

?
pfam11559: ADIP 
Afadin- and alpha -actinin-Binding
This family is found in mammals where it is localized at cell-cell adherens junctions, and in Sch. pombe and other fungi where it anchors spindle-pole bodies to spindle microtubules. It is a coiled-coil structure, and in pombe, it is required for anchoring the minus end of spindle microtubules to the centrosome equivalent, the spindle-pole body. The name ADIP derives from the family being composed of Afadin- and alpha -Actinin-Binding Proteins localized at Cell-Cell Adherens Junctions.
Statistics
?
PSSM-Id: 314452
View PSSM: pfam11559
Aligned: 19 rows
Threshold Bit Score: 92.3867
Threshold Setting Gi: 564339189
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6C1M1         2 EAAAEFINHTLVSKGYLLSDRLKFATvskt-------------------plenVEENDMLVINTIYSLLQSLEKDSKAEE 62  Yarrowia lipoly...
Q245H7        90 ANDLKQINDALQSYGYNRIGNLFEVS----------------------------NDNIEQAINTIRSLLQQRQRDLEFRQ 141 Tetrahymena the...
A0BKF3        49 QNQIKNIREKLIMMGFPSLGDLYSNS----------------------------NSEVDLTVKVLVAVIKQRREDMDFKN 100 Paramecium tetr...
Q8GW47        35 ENCIKYLNQSLVTSGFSASLDLFATD----------------------------PVSIARTCNCVYALIQQRQRDVEFRE 86  thale cress
Q8CGZ2        63 EQSISYLDQELTTFGFPSLYEESKSKea------------------------kRELSIVALLNCMNELLVLQRKNLLAQE 118 Norway rat
EDK38180      10 RNAADLINSTLLSKGYVDEKLYFNTIdwshlssdqp-------qqvslettdvVYNNDKNIINIVFSLLKSIERNKAQNQ 82  Meyerozyma guil...
XP_001634588 200 DQCIAFLNQELGILGFPSLFAKNSNShkp---------------------gceGTFDIVRLINTTYELLQLQQQNQRTRT 258 starlet sea ane...
XP_001384912  14 RHASDLINSMLLSRAYTDQKIQFTTIdwddlirdqvldneevpkinelkvtekLYENDRATINIIHSLLVALDRNRGQQK 93  Scheffersomyces...
XP_006233520  13 vhthdptvhthdptvhthdprvhthdptvhthdptvhthvptvhthdptvhthdptvhshvprvhshvprvhttkngigg 92  Norway rat
CAG07108      40 pQCISYMNQELSSLGFSSPSIGHTSPg-------------------------nPGLNTVAALNVMYELVQIHRRSMCTLE 94  spotted green p...
Q6C1M1        63 NRLRRVADLEHDNDRLRNEIRALHRKNHDL-HTRLA-HEENALQNAKREIARLEAAAKNERGSLTRAKMAVDRFKQQSMV 140 Yarrowia lipoly...
Q245H7       142 LHHETAKRDQNDIAQMHNAIEKLQIRNKQL-QTELD-VVNQKLKNQERDYRDEKEKLNSQLRDITLQYSKIVNRETQFNN 219 Tetrahymena the...
A0BKF3       101 TYHERVNKIEAEKQQLVSNFERVSNNRKIL-EQENT-TLQAKIKSTEKVQKEQINKLMLEREDLQKQLSKLQSRSTQFEH 178 Paramecium tetr...
Q8GW47        87 SANDQRQRLLSDMARLEAKVERLETQLQAK-ERELG-SVTRTEAKNTAALKTQNEKLQKERDEFQRMVIANQQVKTQQLH 164 thale cress
Q8CGZ2       119 SVETQNLKLGSDMDHLQSCYAKLKEQLEAS-RREMI-SLQERDRQLQCKNRNLHQLLKNEKEEVQKLQNIIASRATQYNH 196 Norway rat
EDK38180      83 AFNRQLSQKDATIANLNKKIDQLTTQVSQQ-QMQISkLYQFDHTQLNKKVQSLTQINKLQSQDLNRLNNWCKDIKTKYGV 161 Meyerozyma guil...
XP_001634588 259 SLEERNLRSECDNEFLITSQNRLKEQVESL-QREIA-QSQENERQLQGSIKKLKVQLKNETDEVRRLKMNAVQQKKQFAH 336 starlet sea ane...
XP_001384912  94 LSNQTIHQKDATIESLKSRISLLETQLAQS-ENKVDkLVHFDQNELNKRITDLSRHNKIQAQDLNKLRNWAGDIKTKYRV 172 Scheffersomyces...
XP_006233520  93 msqtasdpkdvqhcrgdcsllwplEQLEAS-RREMI-SLQERDRQLQCKNRNLHQLLKNEKEEVQKLQNIIASRATQYNH 170 Norway rat
CAG07108      95 ELEKDHLKKSSSLEHMQSSNSRLKARRSSSgTTEKF-GLHETERQLQLKIKTLQSCLKTEKDEVQKLQNIIASRATQYSH 173 spotted green p...
Q6C1M1       141 EMRKRDVRLERMRELARK 158 Yarrowia lipolytica
Q245H7       220 EFRKKDTMIKQLQDQIKK 237 Tetrahymena thermophila SB210
A0BKF3       179 ELKQRDLEIQKLKDHIKK 196 Paramecium tetraurelia
Q8GW47       165 ETKKKEKEYIKLQERLNQ 182 thale cress
Q8CGZ2       197 DVKRKEREYNKLKERLHQ 214 Norway rat
EDK38180     162 EIRRRNIEITSLKSKLLE 179 Meyerozyma guilliermondii ATCC 6260
XP_001634588 337 DKKKQEREMNKLKERMHQ 354 starlet sea anemone
XP_001384912 173 ELKKKTLEISELKNKLLE 190 Scheffersomyces stipitis CBS 6054
XP_006233520 171 DVKRKEREYNKLKERLHQ 188 Norway rat
CAG07108     174 DAKRKEREAAKLKERLSQ 191 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap