2AL3


Conserved Protein Domain Family
TUG-UBL1

?
pfam11470: TUG-UBL1 
Click on image for an interactive view with Cn3D
TUG ubiquitin-like domain
TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly. TUG releases the GLUT4 containing vesicles to the cellular exocytic machinery in response to insulin stimulation which allows translocation to the plasma membrane. TUG has an N-terminal ubiquitin-like domain (UBL1) which in similar proteins appears to participate in protein-protein interactions. The region does have a area of negative electrostatic potential and increased backbone motility which leads to suggestions of a potential protein-protein interaction site. This domain is also found at the N-terminus of yeast UBX4.
Statistics
?
Aligned: 109 rows
Threshold Bit Score: 48.6513
Threshold Setting Gi: 74585366
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AL3_A        16 APNGRRHTVKVTPSTVLLQVLEDTCRRQDF-NP-SEYDLKFQRTVL-DLSLQWRFANLPNNAKLEM 78  house mouse
EFJ49162      12 qlqLQRHVVKATAMAPLSSLLAEACAKMKPpLDhSRATLLFNKKPLtDLSCPFRLANIPNGSNLML 77  Volvox carteri f. nagariensis
EEQ41174       8 SYQNVSKKIQCPNTHTVNQLIELSLAKFNLsSS--FGELSSGGKKL-DALLPIRYTNLVNNAKLTL 70  Clavispora lusitaniae ATCC 42720
Q6BW80         9 SFSNTNKKVTSVKSQSVNQLIQTALEKFKIdGQ--QGELFHNGKKL-DSSLPIRLTNLVNNSKLVL 71  Debaryomyces hansenii
XP_001486140  23 VYGNITKRVEARKSDTVHQLTNICMQKYKIdSNm-RGELHYNGKRL-DSLLPIRLANLANNSRLTL 86  Meyerozyma guilliermondii ATC...
CCE78675       9 SFNNVTKKLTYSKTQTINEVLRDCTTKFKIpGS--AGELRYNGKKL-DDSLPIRLTNLINNSKVvf 71  Millerozyma farinosa CBS 7064
ABN66163       9 SYNSITKKVTVPRSNTVQQLIAVSLDKFSInSGkYGGQLYHNNKLL-ESSLSLRLANLINNSKLTL 73  Scheffersomyces stipitis CBS ...
Q59YG7        76 NQPLQGKKITVPKSTSINQLILQALTVYKIdPNnYEGQLYHNGKLL-DGSLPIRLTNLLNNAKLNL 140 Candida albicans
EFA75700       7 LYKNDKTVVQFTPNTFLSEILKKGCTQFKLaDVs-LYALTHNQKPV-NLSLPFRLSGIPNSSRVTi 70  Heterostelium album PN500
EGC37983       8 IYKSGKFTVPVIASNSMLEVFKKGCQHFKLnDS--SHQLMYGNTNV-NLSLPYRLSGIPNLSRVTi 70  Dictyostelium purpureum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap