1YCY


Conserved Protein Domain Family
DUF3202

?
pfam11451: DUF3202 (this model, PSSM-Id:151890 is obsolete)
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3202)
This archaeal family of proteins has no known function.
Statistics
?
PSSM-Id: 151890
View PSSM: pfam11451
Aligned: 2 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....*..
1YCY_D       4 ESLLEKVLKEWKGHKVAVSVGGDHSFTGTLEDFDEEVILLKDVVDVIGNRGKQXLIGLEDINWIXLL 70
gi 74505759  5 QYLLDKTLERWKGQRVAVGIGSEISFSGILEDFDEEVILLKNVTDYAGNKARELIVKIDDMNWITLL 71
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap