1RKI


Conserved Protein Domain Family
DUF3195

?
pfam11424: DUF3195 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3195)
This archaeal family of proteins has no known function.
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 66.2297
Threshold Setting Gi: 60593444
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RKI_A     4 HIIIKTIPKKEEIISRDLCDCIYYY-DNSVICKPIGPSKVYVSTS-LENLEKCLQLHYFKKLVKNIEIFDEV--HNSKPN 79  Pyrobaculum aerophilum
Q8ZYK2     4 HIIIKTIPKKEEIISRDLCDCIYYY-DNSVICKPIGPSKVYVSTS-LENLEKCLQLHYFKKLVKNIEIFDEV--HNSKPN 79  Pyrobaculum aerophilum
CCC82462   2 IALLTTLGGKERSVAQDLCDCLYGNgDTQVRCEPIYPGVLFVEFQrRETLELCLSMKYFRVLVRRIEIYEKVvrSTETPP 81  Thermoproteus tenax...
1RKI_A    80 CDKCL 84  Pyrobaculum aerophilum
Q8ZYK2    80 CDKCL 84  Pyrobaculum aerophilum
CCC82462  82 GAKKV 86  Thermoproteus tenax Kra 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap