Conserved Protein Domain Family
DUF3164

?
pfam11363: DUF3164 
Protein of unknown function (DUF3164)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 314333
View PSSM: pfam11363
Aligned: 16 rows
Threshold Bit Score: 272.616
Threshold Setting Gi: 822612088
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7NW29         8 YKQDGKGRLVPINIIKPIDIARDEFVAEALQKAVAMQDQLAQFKAGLFADIDAFVALSAERYKADVGGEKGNVTLTSFDG 87  Chromobacterium...
Q8EDT3        12 FRLNALGHAVPESQIKEIDKLRDELVLQIVTAAKEMQGHMATYKATSMRAVADFIDLSASEFGVKFGGTKGNVSLVSFDG 91  Shewanella onei...
Q8EJ25        14 YRKNAVGDLVHEDRIKPVDKLRDEVVKAIVDNAKLLRQSMTEFKLTTMANINDFVELSSSEYGTKFGGAKGNILLTSFDG 93  Shewanella onei...
Q3IGH8         8 YLKDGKGNLVAVANVKATDLIKDEFVKKAIKCAEDMQAQLAEFKLALMAEADDFIELLAQEHGVNLGGKKGNVTLRTFDS 87  Pseudoalteromon...
Q6D0U9         8 YMTDRKGRLVPISHVSDYDLAMDAFVNDGVASAEIKSADLGDFKKHSFDECYAFMDLVAEKYGRTRGGVKGNVTFSSFDG 87  Pectobacterium ...
Q2NUT0         9 YMKDRKGRLVPVDQVSDYDLAMDSFVKEQVVAAKVKRDELSDFKRRAFDECYAWLDLVAEKYGRTRGGAKGNVTFSSFDG 88  Sodalis glossin...
Q1GXQ3        10 YRQNARGDLVLESKIKPIDLARDQLVQEKFEKAQALSSALRAFKDDTFADIQAFVEMSGEIYGAKLGGQKGNVSLVSFDG 89  Methylobacillus...
WP_011526918  20 YMKNTQGHFILKEHIKPIDIERNNFVMQCVNKVKKIQKQLKELKKELTTDLNTFIQQTAKQYKVDMGGVKGNITLMSFDG 99  Lawsonia intrac...
WP_012116491  24 YMADAKGALVPLALVKPVDKLTDEAVRKMIHFARDLSAQIGRFRGHCFDDVGSLQALIAQEYGATVGGQKGNISLTTVDG 103 Xanthobacter au...
WP_002442892  11 YRINAQGHYVPESQVKPLDKLRDDVVLRIIEAAKKQRQAMAEFKLQAMSEVADFIDVSAAEYGVEYGGTKGNVTLVSFDG 90  Enterobacteriaceae
Q7NW29        88 NTRVLRAIADTLTFDEGLLAAKALIDECVQEWTEDARPEVKALISDAFQVDKAGNISTGRVLGLRRLDIQDE--KWQRAM 165 Chromobacterium...
Q8EDT3        92 KYKVQRSIGEHRVFDERIQAAKSKIDDCIKRWSVGSNDHIKALVELSFKVNKQGYIDINQVLSLRQLDIDDT--DWRSAM 169 Shewanella onei...
Q8EJ25        94 QYQVRRAVGEHRVFDERIQTAKTLIDDCIKSWSGGADTRLMAMVEHAFRVNQQGRIDVNQVLSLRQLDIDDP--KWKQAM 171 Shewanella onei...
Q3IGH8        88 QLKVTLQTQERIELGPELALAKQLIDQCLDEWTEGGNQNIRAIVSNVFNTDKQGSLNPQRILGLRKLEISDDsgKWTKAM 167 Pseudoalteromon...
Q6D0U9        88 NKQITIKVQESLTFGPELHIAKELIDECVKEWSQGADEKLLALISDAFQVDKEGNLSTTRILSLRRVKIDDE--RWKKAM 165 Pectobacterium ...
Q2NUT0        89 AQQITIRVQETLTFGPELQIAKDLIDECVTEWSEGANANLRAIISDAFQVDKEGQLNTGRILSLRRVKIQDE--RWNRAM 166 Sodalis glossin...
Q1GXQ3        90 RYKIQRAIAESLTFDERLQAAKSLIDECIHNWSQGANDNIRVLVNDAFQVDKEGNINTGRVLGLRRLNIVDE--KWNKAM 167 Methylobacillus...
WP_011526918 100 NYQIKKQMVERISFDEGLQVAKAIIDECIRIWSQSSPGELRAVIEHAFKIDKEGKINTNAILALRRLNIKDP--RWEQAM 177 Lawsonia intrac...
WP_012116491 104 TLKVQVQVADLIEFGAELQAAKKLLDACLSEWAEGSRDEIRALVTRAFQVDKEGVVNRAELFMLLRFDSPDE--RWRSAM 181 Xanthobacter au...
WP_002442892  91 RYKLVRAVGEHRVFDERIQAAKTLIDTCISEWSGGADEKIMALVDHAFRVNKQGKIDINQVLGLRQLNIDDI--KWNEAM 168 Enterobacteriaceae
Q7NW29       166 RALSESVRVQCSKAYVRIERRsEGTGKFEAVRLDLAG 202 Chromobacterium violaceum
Q8EDT3       170 DAIADSIQVMGSTPYLRVYER-QDDGTYKQISLDIAK 205 Shewanella oneidensis
Q8EJ25       172 DAIADAIQITGTSQYLRLYER-QPNGKYTQLPLDISt 207 Shewanella oneidensis
Q3IGH8       168 NIIAESVGVVDSCRFIRFYKQ-DDKGIEQPISLDIAK 203 Pseudoalteromonas haloplanktis TAC125
Q6D0U9       166 EAISESLLVAVSKTYINFRKK-DESGKLVNIPLDIAA 201 Pectobacterium atrosepticum
Q2NUT0       167 EAISESLQVAMSKTYINFREK-DKHGKLINIPLDIAA 202 Sodalis glossinidius str. 'morsitans'
Q1GXQ3       168 DAISDAVQVTGSKSYLRFYERvGDTDQWKPLALDMAS 204 Methylobacillus flagellatus KT
WP_011526918 178 QAIVDSIHLVETKSYIRIYER-MPDGKLKNISLEMSS 213 Lawsonia intracellularis
WP_012116491 182 AAIRDSIRVIGSKTYIRFYERaAPDAQWQSISIDLAR 218 Xanthobacter autotrophicus
WP_002442892 169 DAVADAIQVTGTSQYLRLYER-QADGGYQQISLDLAK 204 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap