Conserved Protein Domain Family
Tho2

?
pfam11262: Tho2 
Transcription factor/nuclear export subunit protein 2
THO and TREX form a eukaryotic complex which functions in messenger ribonucleoprotein metabolism and plays a role in preventing the transcription-associated genetic instability. Tho2, along with four other subunits forms THO
Statistics
?
PSSM-Id: 337963
View PSSM: pfam11262
Aligned: 137 rows
Threshold Bit Score: 155.06
Threshold Setting Gi: 121975976
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q18033        863 ENIPVKFFAVFWMLTMYDIEVPTAAYERTLDALKKQSRE------------------------------------D-SHG 905  Caenorhabditi...
Q4Z0M8        232 NGINIKFYLIYWRLHISDIYVPHKQYKKIIDNFDMLINKlekyfv-------------------------dnkkhG-DLN 285  Plasmodium be...
Q8I4T6       2413 NGININFYLTYWRLSISDIYVPHKQYQKVLDKYENYIKKlekyye-------------------------enkknD-EYK 2466 Plasmodium fa...
Q4N3V4        402 TMLDDNFVGFINSLSIYDIYSPTEQYDTYVSKLTSFLSTittag----------------------------------ag 447  Theileria parva
Q4UFM1       1521 NILDDNFIGFINNLNIYDIYTPVEQYDNYITKLTSgig------------------------------------------ 1558 Theileria ann...
EJK63366     1088 SIISPHLFETFYSLAIYDILCPEERYKVDIERLNKDCERlvqfqkggeaarsqmaalvaqataaggtemqirqatA-FTK 1166 Thalassiosira...
XP_002291223 1200 KHISLELFEAFHSFSVYDIVCPEERYNSEIGRLKKEVESltqlqkggdaargamasmaasmaaaggtdeqirrstA-FTK 1278 Thalassiosira...
SCO70245     2037 NGINIDFYLTYWRLSITDIYVPHKQYQKVIERYDAYIKKlekhh--------------------------eenkkNeDYK 2090 malaria paras...
XP_002786579 1010 dGLSLGFYLTFWRLSLYDIYVPCDSYKKQIALMEREMVEmqgaadgrpta-------------------atpsptkqtik 1070 Perkinsus mar...
XP_001608714 1048 DTFKPEFMKFIWSIHLSDVWVPIEQYEKTLQRLNAWIAEse---------------------------------sN-HSS 1093 Babesia bovis...
Q18033        906 KAKKTDKQL---ESKLREEQKRQIEHVERCKVWLLNKKDS-LID--EQ---FHNSVLEALIQQCLLPRAIFSELDAVFCG 976  Caenorhabditi...
Q4Z0M8        286 WIHKKIEKLnfrKAQIKNEYEYHILHTNKIKKKLSHIIEH-WVDp-EE---IDFNTFTSFVKCLIAPRILNSEKDSLFCS 360  Plasmodium be...
Q8I4T6       2467 WIPKQIKKLnikKNNLKNEYEYHINHTKQIKQYLAHIVDH-WVDp-QK---VSLNTFVAFIKCLIAPRILNSEKDSLFCS 2541 Plasmodium fa...
Q4N3V4        448 ntFRRAKRIknrITTLETDKEEHLTHSNVVLERLKEVFKS-FVKndAK---VGPHITTRFISRIVFSRLLVSELNALFCC 523  Theileria parva
Q4UFM1       1559 ntVRRIKRIknrITILETDKNEHIQHTNMILSHLKEVLKR-FVKndNK---VGPHITMRFITRIIFPRLFVSELNALFCC 1634 Theileria ann...
EJK63366     1167 EHQAQLDRLrrnIDQLTKDFQRQQLRCKLVQSKLQEDREK-LTAssGA---NSVTFAPAFMTFCVYPRLLLSPQDALFCA 1242 Thalassiosira...
XP_002291223 1279 EHAMKLDRLkhnKDQLSKDFSRQQKRCQLVHSQLKSQKDA-LIVaeESgesSCGEFAPAFMTFCVYPRCFLSPEDGLFCF 1357 Thalassiosira...
SCO70245     2091 WVLKKLRKLrskRGTINSEYQFHIQHTEKIKKHLSHVVDH-WVNp-QE---IDLTTFTAFVKCLIAPRILNSEKDSLFCS 2165 malaria paras...
XP_002786579 1071 RAKKEIHRLkehIDKLRVEETLQLENHHRVLERLRRECGG-WWKq-EV---GNEQATIGLVKWMLAQRVMLSVQDALFCA 1145 Perkinsus mar...
XP_001608714 1094 SGHRKLKKLrsrHAAIEQEFIKQKEHVEQTKKRFSEVVSSgWLSanVQ---IGPAINTAFLQHCIVPRVFINEAEASFCS 1170 Babesia bovis...
Q18033        977 QFFMMLHEMRTPFFPSVLIIDRLFEN--IIPLIAGLTENEANSLACFFEILLCTVQRWHS-------------EKEVFEK 1041 Caenorhabditi...
Q4Z0M8        361 KFIQVLVEFYTPLFNLCTLVQVLTKM--LIPLINSCTEKESLNVGIFFNDLFSYLYVLCD-------------DVKYFHN 425  Plasmodium be...
Q8I4T6       2542 KFIQILLELHTPLFNLCTLVYIFTKM--LMPLINACTEKEALNIGIFFNDFFSYIYLLCE-------------DIKYFQN 2606 Plasmodium fa...
Q4N3V4        524 KIVDLIMENKMNYFNYFDFVNCYTKM--LIPMISSLTEREVINLSIFFNHSFHLIKGWVN-------------NREAFEK 588  Theileria parva
Q4UFM1       1635 KIVDTILENKMNYFNYFDFVNCYTKM--LIPMISSLTEREVISLSIFFNHSFQLIKAWVN-------------DRDAFEK 1699 Theileria ann...
EJK63366     1243 HFVKLLHKTKVPGFLTLELIDVIV-Da-VVAGLFCSSEDEAGNLSIFLNEIWKSANAWRY-------------DNDAFAS 1307 Thalassiosira...
XP_002291223 1358 HFIKMLHKMKVPGFLTIELIDNIINAa--TGSFYCVTEDEAGNLAIFLNEIWKVVNTWRY-------------DNDAFAS 1422 Thalassiosira...
SCO70245     2166 KFILLLLEFRTPLFNFCLLTYVCIKM--LMPIINACTEKEALNIGLFFNELFSYAYQLCQ-------------DPKHFKL 2230 malaria paras...
XP_002786579 1146 HFVKLLVTLHPPGFQLLDFYN--VATtlLMVLVQCCTESEARWFGVFLRDIMHYVKDLRSigdstkfadyvagNSAFYRH 1223 Perkinsus mar...
XP_001608714 1171 HLVDLMLLNRVECFNFFDFSNCWTKM--LMSMVRCCTEREAPLLAIFVNHAFHVIRGWID-------------DAEGFEA 1235 Babesia bovis...
Q18033       1042 -------ECagfpG------MITK---------QAIEYQTFRKLCYRWQIRFTAMFKT---------------------- 1077 Caenorhabditi...
Q4Z0M8        426 isnnnp-cfsntlN------FESK---------ITINHGDIVQKIYKWENYIIALLFD---------------------- 467  Plasmodium be...
Q8I4T6       2607 vsnknp-cfsytlN------FQSK---------DTITHNNIIQKVMKWEKTILSLLFE---------------------- 2648 Plasmodium fa...
Q4N3V4        589 lvydnp-cfcttfK------FQPN---------REFKYQQLLQVIKKWEYFILLSIFSinkpptstnsansansanstts 652  Theileria parva
Q4UFM1       1700 lvydnp-cfcttfK------FQPN---------KEFKYQQLLQVIKKWEYFILLSIFSsvtgsgqtatninkvnstnnsn 1763 Theileria ann...
EJK63366     1308 -------ELkstpGallseeFAKKhgigdhataEGVTHDDYKNLYTDWHIKIGSAAIG---------------------- 1358 Thalassiosira...
XP_002291223 1423 -------ELkdtpGsrlsktFAEEnnmgehsitDGVTHDDYKTLYTKWHLRIGSASIG---------------------- 1473 Thalassiosira...
SCO70245     2231 -------VSeenpC------FSSTlnfq---skvtIEHSFIIGKVAKWEKLLVSLLFE---------------------- 2272 malaria paras...
XP_002786579 1224 yrpygekDA------------------------EYLKLSELKKGHAKWEGRVCKALKP---------------------- 1257 Perkinsus mar...
XP_001608714 1236 mtrdhp-cfcttfK------FVPD---------KALTHAQLMSGIRKWEGRIMRALSYalvlnitd-------------- 1285 Babesia bovis...
Q18033            -------------------------------------------------------------------------------- Caenorhabditi...
Q4Z0M8            -------------------------------------------------------------------------------- Plasmodium be...
Q8I4T6            -------------------------------------------------------------------------------- Plasmodium fa...
Q4N3V4        653 assv----------------------------------------------------------------------kddkgr 662  Theileria parva
Q4UFM1       1764 sikdssstvvtsnkdstsnkvnsstvvtstsntkstttsnkdsntkdskankdtnsikgapfgagnkdskstsstmgstm 1843 Theileria ann...
EJK63366          -------------------------------------------------------------------------------- Thalassiosira...
XP_002291223      -------------------------------------------------------------------------------- Thalassiosira...
SCO70245          -------------------------------------------------------------------------------- malaria paras...
XP_002786579      -------------------------------------------------------------------------------- Perkinsus mar...
XP_001608714      -------------------------------------------------------------------------------- Babesia bovis...
Q18033       1078 -------------------VFtkD-DADYVLIRNSLIMMTKLTSGFPVISHAVATMETA---VTKL---K-DrekgkRDD 1130 Caenorhabditi...
Q4Z0M8        468 -------------------HNnnD-EKTWINYKSIVVFLFRLVNSFPYSSKIKDSIINHlqnLQNI---S-Kah--gWKD 521  Plasmodium be...
Q8I4T6       2649 --------------------NnnF-EKSWINSKSVVIFLFRFLNTFPYSHKIKNSIKTYlenLQNF---A-Nnq--gWKD 2701 Plasmodium fa...
Q4N3V4        663 vgdlknsaesemasepesvLP--Q-KRSWIEIKNVVIFLNKVSSNFPITVNSSLKVLNFlknVLKL---A-Kqn--nWQD 733  Theileria parva
Q4UFM1       1844 gtttgtagastvtgtvtdeSP--I-VQSWIEIKNVIIFLNKVSNNFPITINSSLKVLNFlknVLKL---A-Kqn--nWQD 1914 Theileria ann...
EJK63366     1359 -------------------CL--K-STEYMHTRAALIILSRIVRVFPTQPKTGEKILTT---LEPL---Q-Nde-rtKPD 1408 Thalassiosira...
XP_002291223 1474 -------------------CL--K-SSEYMYTRAALIVLSRIVLVYPTQPKVGDKILDT---LTSL---QgEdn--pRPD 1523 Thalassiosira...
SCO70245     2273 -------------------NN--NhQKSWINSKSVVIFLFRVLHSFPYSNKVKHSIRKY---LQNLhsfA-Qsr--gWKD 2325 malaria paras...
XP_002786579 1258 -------------------GLe-K-SADWSEKRNALTVLISCHEYCPVHYRSARAVMHQ---LEAL---S-Kdq-gqPPD 1308 Perkinsus mar...
XP_001608714 1286 -----------adssgeagAPevV-APTWIDQKGAIVFLARCHENFPITIAAGKRVLNGlngVVVN---A-Eqk--gWKD 1347 Babesia bovis...
Q18033       1131 LSLKAASY 1138 Caenorhabditis elegans
Q4Z0M8        522 ILISINSL 529  Plasmodium berghei
Q8I4T6       2702 IVISINSL 2709 Plasmodium falciparum 3D7
Q4N3V4        734 VTVPSNTL 741  Theileria parva
Q4UFM1       1915 VTVSSNTL 1922 Theileria annulata
EJK63366     1409 IRATAQGY 1416 Thalassiosira oceanica
XP_002291223 1524 IRATAQGY 1531 Thalassiosira pseudonana CCMP1335
SCO70245     2326 IAISVNSL 2333 malaria parasite P. vivax
XP_002786579 1309 IKTMAGGL 1316 Perkinsus marinus ATCC 50983
XP_001608714 1348 VVVAAKTL 1355 Babesia bovis T2Bo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap