Conserved Protein Domain Family
Tho2

?
pfam11262: Tho2 
Transcription factor/nuclear export subunit protein 2
THO and TREX form a eukaryotic complex which functions in messenger ribonucleoprotein metabolism and plays a role in preventing the transcription-associated genetic instability. Tho2, along with four other subunits forms THO
Statistics
?
PSSM-Id: 371438
View PSSM: pfam11262
Aligned: 135 rows
Threshold Bit Score: 157.007
Threshold Setting Gi: 121975976
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT02556         1323 KRISPEFFVTFWALQQGDIVVPRARYDAEIDRLRKESSALknargvqgTENPRAAMMRRNEEAEARL--KERQAIAEEML 1400 Sporothri...
jgi:OSTLU_119527  733 GLVSPEFYLTFWSLNLEDVYVPKELYAK--ARARTVKYGS----------TASSTFDQVTQLPSNVvhdELAESLNVELQ 800  Ostreococ...
A0BH94            916 TIINPELFAIFWLLSLDNIYVPQAIYDQQLKWLQENINKN------------PDTKDRQSKQHQKA-----FDKLQNELD 978  Parameciu...
Q23DD5            894 TLIKPQLYSIFWLLSLENISVNKDGYKFQIEALKKNIQEK--------QSD-KNKKDKEKKELKDLE--SLVKKLEEEEQ 962  Tetrahyme...
EDL44297         2037 NGINIDFYLTYWRLSITDIYVPHKQYQKVIERYDAYIKKLekh--heeNKK-NEDYKWVLKKLRKLR--SKRGTINSEYQ 2111 malaria p...
Q4Z0M8            232 NGINIKFYLIYWRLHISDIYVPHKQYKKIIDNFDMLINKLeky--fvdNKK-HGDLNWIHKKIEKLN--FRKAQIKNEYE 306  Plasmodiu...
Q8I4T6           2413 NGININFYLTYWRLSISDIYVPHKQYQKVLDKYENYIKKLeky--yeeNKK-NDEYKWIPKQIKKLN--IKKNNLKNEYE 2487 Plasmodiu...
EDO05146         1048 DTFKPEFMKFIWSIHLSDVWVPIEQYEKTLQRLNAWIAES----------E-SNHSSSGHRKLKKLR--SRHAAIEQEFI 1114 Babesia b...
Q4N3V4            402 TMLDDNFVGFINSLSIYDIYSPTEQYDTYVSKLTSFLSTItta--gagNT---------FRRAKRIK--NRITTLETDKE 468  Theileria...
Q4UFM1           1521 NILDDNFIGFINNLNIYDIYTPVEQYDNYITKLTSgi----------gNT---------VRRIKRIK--NRITILETDKN 1579 Theileria...
ERT02556         1401 ALGTRNRDTKRHLLVHAQT-WFTnngsSSVtiASASALSDILLEQCLVPRILLSVADAEYAFRFVRFLHENRVPHFQ-LA 1478 Sporothri...
jgi:OSTLU_119527  801 QLIEHVSRGTQCILRKNST-WVQ------T--ADNLSPASVILETCVLPRCKISHADALYCSNFVELVGRSDTDSFS-FI 870  Ostreococ...
A0BH94            979 NNKKRQEQFDKCLRDKKHVfSFKeadqAKE--NYHIKFAQCLSQVCLLPRILIDPAEAIYCAKFVQKMLKIGKPRYT-YT 1055 Parameciu...
Q23DD5            963 KQTKLIAKYESYLQSIKEDiALP----KSR--DQIEAVISELCTSCMLPRLLIEQAEALYCSRFLLLLFRINQSNLNdSV 1036 Tetrahyme...
EDL44297         2112 FHIQHTEKIKKHLSHVVDH-WVN-----PQ--EIDLTTFTAFVKCLIAPRILNSEKDSLFCSKFILLLLEFRTPLFN-FC 2182 malaria p...
Q4Z0M8            307 YHILHTNKIKKKLSHIIEH-WVD-----PE--EIDFNTFTSFVKCLIAPRILNSEKDSLFCSKFIQVLVEFYTPLFN-LC 377  Plasmodiu...
Q8I4T6           2488 YHINHTKQIKQYLAHIVDH-WVD-----PQ--KVSLNTFVAFIKCLIAPRILNSEKDSLFCSKFIQILLELHTPLFN-LC 2558 Plasmodiu...
EDO05146         1115 KQKEHVEQTKKRFSEVVSSgWLS----ANV--QIGPAINTAFLQHCIVPRVFINEAEASFCSHLVDLMLLNRVECFN-FF 1187 Babesia b...
Q4N3V4            469 EHLTHSNVVLERLKEVFKS-FVK----NDA--KVGPHITTRFISRIVFSRLLVSELNALFCCKIVDLIMENKMNYFN-YF 540  Theileria...
Q4UFM1           1580 EHIQHTNMILSHLKEVLKR-FVK----NDN--KVGPHITMRFITRIIFPRLFVSELNALFCCKIVDTILENKMNYFN-YF 1651 Theileria...
ERT02556         1479 TFYQRLFSAnrLRDLIFTSTVREAERVGRFLKLILADLARWHGDKNAYEREAlgqtkngrRSYL------GFVKNS-KAA 1551 Sporothri...
jgi:OSTLU_119527  871 QYYDTLFRN--VSYLIYACSEFENKFFATFLTSGMAQLTRWRAC-DVYKRECwq--------------rsEFRNCLnQSS 933  Ostreococ...
A0BH94           1056 FYVPKEIIYf-TFTYLQCATEEEASNLSIFMQQLIIPYANWN-DETKFKN--------------------DLRNYFdT-- 1111 Parameciu...
Q23DD5           1037 RSIRQAVTK--ILPFLQNATEKEAINISYFVNDIFKPFSNYLEGPEKLQE--------------------SLKTHIhSQI 1094 Tetrahyme...
EDL44297         2183 LLTYVCIKM--LMPIINACTEKEALNIGLFFNELFSYAYQLCQDPKHFKLv--------sEENPcfsstlNFQSK----- 2247 malaria p...
Q4Z0M8            378 TLVQVLTKM--LIPLINSCTEKESLNVGIFFNDLFSYLYVLCDDVKYFHNi--------sNNNPcfsntlNFESK----- 442  Plasmodiu...
Q8I4T6           2559 TLVYIFTKM--LMPLINACTEKEALNIGIFFNDFFSYIYLLCEDIKYFQNv--------sNKNPcfsytlNFQSK----- 2623 Plasmodiu...
EDO05146         1188 DFSNCWTKM--LMSMVRCCTEREAPLLAIFVNHAFHVIRGWIDDAEGFEAm--------tRDHPcfcttfKFVPD----- 1252 Babesia b...
Q4N3V4            541 DFVNCYTKM--LIPMISSLTEREVINLSIFFNHSFHLIKGWVNNREAFEKl--------vYDNPcfcttfKFQPN----- 605  Theileria...
Q4UFM1           1652 DFVNCYTKM--LIPMISSLTEREVISLSIFFNHSFQLIKAWVNDRDAFEKl--------vYDNPcfcttfKFQPN----- 1716 Theileria...
ERT02556         1552 AkpagkaaatssesaeggkdkdnkvnednedgpTYIEHTEFRDLLY-SWHKNLNMALKD--------------------- 1609 Sporothri...
jgi:OSTLU_119527  934 ---------------------------------VEASFKDYLRVLY-KWEHRLTKGILR--------------------- 958  Ostreococ...
A0BH94           1112 ---------------------------------SIDGYDREKQYII----QNIFFKMAQ--------------------- 1133 Parameciu...
Q23DD5           1095 In-------------------------------EKYSYDKYSNYIHsNIIDEVFKIAQQ--------------------- 1122 Tetrahyme...
EDL44297         2248 ---------------------------------VTIEHSFIIGKVA-KWEKLLVSLLFE--------------------- 2272 malaria p...
Q4Z0M8            443 ---------------------------------ITINHGDIVQKIY-KWENYIIALLFD--------------------- 467  Plasmodiu...
Q8I4T6           2624 ---------------------------------DTITHNNIIQKVM-KWEKTILSLLFE--------------------- 2648 Plasmodiu...
EDO05146         1253 ---------------------------------KALTHAQLMSGIR-KWEGRIMRALSYalvlnitd------------- 1285 Babesia b...
Q4N3V4            606 ---------------------------------REFKYQQLLQVIK-KWEYFILLSIFSinkpptstnsansansanstt 651  Theileria...
Q4UFM1           1717 ---------------------------------KEFKYQQLLQVIK-KWEYFILLSIFSsvtgsgqtatninkvnstnns 1762 Theileria...
ERT02556              -------------------------------------------------------------------------------- Sporothri...
jgi:OSTLU_119527      -------------------------------------------------------------------------------- Ostreococ...
A0BH94                -------------------------------------------------------------------------------- Parameciu...
Q23DD5                -------------------------------------------------------------------------------- Tetrahyme...
EDL44297              -------------------------------------------------------------------------------- malaria p...
Q4Z0M8                -------------------------------------------------------------------------------- Plasmodiu...
Q8I4T6                -------------------------------------------------------------------------------- Plasmodiu...
EDO05146              -------------------------------------------------------------------------------- Babesia b...
Q4N3V4            652 sassv----------------------------------------------------------------------kddkg 661  Theileria...
Q4UFM1           1763 nsikdssstvvtsnkdstsnkvnsstvvtstsntkstttsnkdsntkdskankdtnsikgapfgagnkdskstsstmgst 1842 Theileria...
ERT02556         1610 --------------------CL--ENLEWTHIRNAISVLKAVMDAFPAVDFMGRQFADQ---LQRIAARESatnnatpea 1664 Sporothri...
jgi:OSTLU_119527  959 --------------------NL--QNEDYMEVANSLSSLIAIVDTFPVTELLGNYIYSQ---VKRISMRDK--------- 1004 Ostreococ...
A0BH94           1134 --------------------FIriLKNNETQVRNALIFLKRVQDIFPPTQQVAEYIKIY---LQDVEKDYGh-------- 1182 Parameciu...
Q23DD5           1123 ------------------------ITKNESQVRNILILLNQIKEIFPKTRQQGQECKKL---MEQLLEKYP--------- 1166 Tetrahyme...
EDL44297         2273 ---------------------NnnHQKSWINSKSVVIFLFRVLHSFPYSNKVKHSIRKYlqnLHSFAQSRG--------- 2322 malaria p...
Q4Z0M8            468 --------------------HNnnDEKTWINYKSIVVFLFRLVNSFPYSSKIKDSIINHlqnLQNISKAHG--------- 518  Plasmodiu...
Q8I4T6           2649 ---------------------NnnFEKSWINSKSVVIFLFRFLNTFPYSHKIKNSIKTYlenLQNFANNQG--------- 2698 Plasmodiu...
EDO05146         1286 ------------adssgeagAPevVAPTWIDQKGAIVFLARCHENFPITIAAGKRVLNGlngVVVNAEQKG--------- 1344 Babesia b...
Q4N3V4            662 rvgdlknsaesemasepesvLP--QKRSWIEIKNVVIFLNKVSSNFPITVNSSLKVLNFlknVLKLAKQNN--------- 730  Theileria...
Q4UFM1           1843 mgtttgtagastvtgtvtdeSP--IVQSWIEIKNVIIFLNKVSNNFPITINSSLKVLNFlknVLKLAKQNN--------- 1911 Theileria...
ERT02556         1665 sqRIDLSVTARAI--YSEL 1681 Sporothrix schenckii ATCC 58251
jgi:OSTLU_119527 1005 --RDDIKTISNRY--LSLL 1019 Ostreococcus lucimarinus CCE9901
A0BH94           1183 --IQDIKTQIKNFhiedki 1199 Paramecium tetraurelia
Q23DD5           1167 --KEQYKSVGTKIdvYYKL 1183 Tetrahymena thermophila SB210
EDL44297         2323 --WKDIAISVNSL---KTI 2336 malaria parasite P. vivax
Q4Z0M8            519 --WKDILISINSL---KQI 532  Plasmodium berghei
Q8I4T6           2699 --WKDIVISINSL---KTM 2712 Plasmodium falciparum 3D7
EDO05146         1345 --WKDVVVAAKTL--VKTF 1359 Babesia bovis
Q4N3V4            731 --WQDVTVPSNTL--IKLI 745  Theileria parva
Q4UFM1           1912 --WQDVTVSSNTL--IKLI 1926 Theileria annulata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap