Conserved Protein Domain Family
DUF3042

?
pfam11240: DUF3042 
Protein of unknown function (DUF3042)
This family of proteins with unknown function appears to be restricted to Firmicutes.
Statistics
?
PSSM-Id: 314231
View PSSM: pfam11240
Aligned: 28 rows
Threshold Bit Score: 46.5018
Threshold Setting Gi: 81454012
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 122449181  1 MKKFNLGFLLGVTTTLGALAGAVFTFKKNVVEPIEEKEAILEEHRRRALRKSRS 54
gi 81537856   2 nRTFIKGFLAGNALLIAGLAATAIGIKAKVINPIKKKEEQIEMGRKRAARKRIA 55
gi 122271006  1 MKSFKLGVIIGTFGTAAAVAGSALVYRHKVIKPIEKAEEEYNEVSKAAIRRSVA 54
gi 257803749  1 MKRFLSGFLVGTVATIAAAASVVMTVKKQVIDPIDEQQALNEEKRKRAMRKSVS 54
gi 348602266  1 MKKFTLGFIVGSLATTAATACLVQSVKKQVIEPIEEKEAMIDENRKKARRKSFA 54
gi 343180678  2 NKNLITGFVAGNIVTLAALFTAGAIYKKRVVDPIEHKWEFAQESRKKANRKRIA 55
gi 493899153  1 MKKFGLGMLTGVVGTIASLAGVAKVYHKIAIEPIEKEEAQFEATEIRGARKagn 54
gi 489760092  1 MKQLAKGILVGSLATVAAIASGVLTFHKTVIKPAEEEEEKFDQNRRAAIRKGRS 54
gi 329128868  1 MKQFTNGLIVGVLGTVAAGVGALLTFKKSVVDPIEDEEQKFEDNRKKAMRKSRA 54
gi 498429366  1 MKKFVSGILVGSLATVAAVAGLVTSVKKTVIDPIDEKEAMIEENRKKAMRKRVS 54
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap