Conserved Protein Domain Family
DUF2968

?
pfam11180: DUF2968 
Protein of unknown function (DUF2968)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 337939
View PSSM: pfam11180
Aligned: 22 rows
Threshold Bit Score: 165.592
Threshold Setting Gi: 123766011
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2KX91        42 GAEPVTPPAAAQAapvapcANSTATELQNLIQARQVSELRTAYNGSYGASLLFRPEDQSYFVALFQQKDFWRVIKTNSAS 121 Bordetella aviu...
Q8XXF0        28 ATAPQTQASAPAA------STGSVAELRQLLAQKRLTELRTTYNGDYGTSLLLVNEDTTAYVALSYRRELWRVYKFGAAA 101 Ralstonia solan...
Q7VX21        45 AAAPVEPPAPAPAa----rPASTVSELQGLIQARQVSELRTTYNGSYGASLLYKPDELTYYVALFQQKDFWRVLKTKSVN 120 Bordetella pert...
Q8XQZ0        65 SASDSAARADTPA------ANSAVLELQRRMQARELAELRTTYNGAYGASLLFAQRDLTYYVTLFQQKDLWCVIKTTNEA 138 Ralstonia solan...
Q13Q61        67 RPVPVVPSQVSVRg----vQVADTAEVEWLAEEEALTPFRVFRSFAYSVSLLFHAKELAYYVALYQDGSLWRALKAADLE 142 Paraburkholderi...
WP_023874601  38 apaarSQTTAPAA------ASGTIQELRDRIQNKEVTELRTTYNGRYGASLLFYPQTMGYYVALFHEGQFWRAVKLNNEK 111 Pandoraea pnome...
WP_012430295  76 PATPGAARAERPA------PTSAVFELQQRMQAHELSELRTTYNGAYGASLLFAQSDLTYYVTLFQQKDLWRVIKTTNEA 149 Ralstonia picke...
WP_012480553  37 DREAAAEPAARSAp----vVRNTVDELKQLMDSRQLTELRTTYNGNYGASLLFNANTLTYYVALFQEKNFWRVIKTDAVD 112 Stenotrophomonas
WP_014004852  38 AVSPTPPTAPQPA------ANSTISELQQLMQSQSISEMRTTYNGNYGASLLFKPESRTYYVALFQQKNFWRVVKTQSDG 111 Collimonas fung...
WP_012250268  46 GDTPVTPPAPQAK------ANSTVAELQSLIQSRQVSELRTTYNGTYGASLLFKPDDLTYYVALFQQKDFWRVVQTQSDK 119 Bordetella petrii
Q2KX91       122 QAETAYRSFVARSAELAEIEIRRIQLQAQYAQAEQQLAARSAELAALQADQALRQAQEEAVAARQAQSRQEAQVLGEQNQ 201 Bordetella aviu...
Q8XXF0       102 PAEAAYDMLARQTRAWAEDDVRHAVAAGQKAQLEREAQAAEQRAAALSQEVRAMQAQRQQMLEEQQAARRQTQALDAERH 181 Ralstonia solan...
Q7VX21       121 QAESTYRAFASKTAELAEVDIQRIRLQAEYAHAEKQLGARNAELTALQADQALRQQQEQQVAVRQAQSRQEADSLSEQRQ 200 Bordetella pert...
Q8XQZ0       139 HAERIYADFSRQTRSLSDLDLQRLRLEAQKERAERQIAEQEGRLRGLRADLDLQRQQQAQVQARQKVARTEADTLDTDRR 218 Ralstonia solan...
Q13Q61       143 AAEAAFHHFEEQATRLSDGETRRAQLEAQNEQLARMIARSEAQAERLRSELQRRGTQEQTVASRQHQVRKDVSQLEAQRV 222 Paraburkholderi...
WP_023874601 112 KAESLYADFVRQTQVLADVEIRRIKLEAQRAMMERQLAESEARLNAVQSDLAIQRQQEQALAQNQQAVREQASALETERN 191 Pandoraea pnome...
WP_012430295 150 SAERLYSDFAKQTRTMADLELQRIRLEAQKERSERQIAAQQEKLRGLKTDLDIQRQQQAQAQERQKVARTEAEALDIERR 229 Ralstonia picke...
WP_012480553 113 NAERVYRTFAQQSEQLAQVYIDTTRLEAGKRYTERLVAYNEERLRTLQQEMEQQQAQSAQVSAALQQAQQQAVSLSTDVQ 192 Stenotrophomonas
WP_014004852 112 QAEQIYKSFVGQTEKLAEVDIRRIKLEAEKTYTEQLIAAQETRLNALQNDLVVQQQQEQNVSVQQDQARQQAQLLSNKQQ 191 Collimonas fung...
WP_012250268 120 QAESTYRAFAQQSADLAEVDIKRIKLQAEYARSERLLAERSSELATLQADQSLRRQQEQQVAARQEQARQQAAALSQQQQ 199 Bordetella petrii
Q2KX91       202 DLREQLRALQRQIDALQAEQMR 223 Bordetella avium 197N
Q8XXF0       182 AYKTQIDSLQQQIRLLEKQLND 203 Ralstonia solanacearum
Q7VX21       201 EVRSQLRAMQRQIDALQAEQAR 222 Bordetella pertussis
Q8XQZ0       219 AARARLDELQRQIRSLEAQVNA 240 Ralstonia solanacearum
Q13Q61       223 AAQAHLNKTHRQIHQLNLTSNE 244 Paraburkholderia xenovorans LB400
WP_023874601 192 AARIRLTDLQGQIRSLEAEQNS 213 Pandoraea pnomenusa
WP_012430295 230 AARARVDELQRQIRELEAQVNA 251 Ralstonia pickettii
WP_012480553 193 STNSQLDALQRRIQILQAEQGN 214 Stenotrophomonas
WP_014004852 192 AARNELRGLQNRIRTLEAQQTi 213 Collimonas fungivorans
WP_012250268 200 QLRKELSAMQRQIDALQAEQAE 221 Bordetella petrii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap