Conserved Protein Domain Family
DUF2968

?
pfam11180: DUF2968 
Protein of unknown function (DUF2968)
This family of proteins has no known function.
Statistics
?
Aligned: 21 rows
Threshold Bit Score: 166.356
Threshold Setting Gi: 123766011
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2KX91                 42 GAEPVTPPAAAQAapvapcANSTATELQNLIQARQVSELRTAYNGSYGASLLFRPEDQSYFVALFQQKDFWRVIKTNSAS 121 Bordet...
nioo:CFU_0864          38 AVSPTPPTAPQPA------ANSTISELQQLMQSQSISEMRTTYNGNYGASLLFKPESRTYYVALFQQKNFWRVVKTQSDG 111 Collim...
CAP43712               46 GDTPVTPPAPQAK------ANSTVAELQSLIQSRQVSELRTTYNGTYGASLLFKPDDLTYYVALFQQKDFWRVVQTQSDK 119 Bordet...
Q7VX21                 45 AAAPVEPPAPAPAa----rPASTVSELQGLIQARQVSELRTTYNGSYGASLLYKPDELTYYVALFQQKDFWRVLKTKSVN 120 Bordet...
jgi:Rpic_4257          76 PATPGAARAERPA------PTSAVFELQQRMQAHELSELRTTYNGAYGASLLFAQSDLTYYVTLFQQKDLWRVIKTTNEA 149 Ralsto...
Q8XQZ0                 65 SASDSAARADTPA------ANSAVLELQRRMQARELAELRTTYNGAYGASLLFAQRDLTYYVTLFQQKDLWCVIKTTNEA 138 Ralsto...
jgi:Rpic_2366          28 ASAPQAPAVSTAA------SGGTVAELQQLLAQKRLTELRTTYNGDYGTSLLLVNEDTTAYVALSYRKELWRVYKFASVA 101 Ralsto...
Q8XXF0                 28 ATAPQTQASAPAA------STGSVAELRQLLAQKRLTELRTTYNGDYGTSLLLVNEDTTAYVALSYRRELWRVYKFGAAA 101 Ralsto...
calssnu:BYI23_A020080  47 DLSDLNADSNAPR------VEGNIAELQNLVQAGSLTELRATRNGSYGAKLFFLAQDMLYYVALSQDARWWRVVKTQDAA 120 Burkho...
Q13Q61                 67 RPVPVVPSQVSVRg----vQVADTAEVEWLAEEEALTPFRVFRSFAYSVSLLFHAKELAYYVALYQDGSLWRALKAADLE 142 Parabu...
Q2KX91                122 QAETAYRSFVARSAELAEIEIRRIQLQAQYAQAEQQLAARSAELAALQADQALRQAQEEAVAARQAQSRQEAQVLGEQNQ 201 Bordet...
nioo:CFU_0864         112 QAEQIYKSFVGQTEKLAEVDIRRIKLEAEKTYTEQLIAAQETRLNALQNDLVVQQQQEQNVSVQQDQARQQAQLLSNKQQ 191 Collim...
CAP43712              120 QAESTYRAFAQQSADLAEVDIKRIKLQAEYARSERLLAERSSELATLQADQSLRRQQEQQVAARQEQARQQAAALSQQQQ 199 Bordet...
Q7VX21                121 QAESTYRAFASKTAELAEVDIQRIRLQAEYAHAEKQLGARNAELTALQADQALRQQQEQQVAVRQAQSRQEADSLSEQRQ 200 Bordet...
jgi:Rpic_4257         150 SAERLYSDFAKQTRTMADLELQRIRLEAQKERSERQIAAQQEKLRGLKTDLDIQRQQQAQAQERQKVARTEAEALDIERR 229 Ralsto...
Q8XQZ0                139 HAERIYADFSRQTRSLSDLDLQRLRLEAQKERAERQIAEQEGRLRGLRADLDLQRQQQAQVQARQKVARTEADTLDTDRR 218 Ralsto...
jgi:Rpic_2366         102 PAEGAYETLTGQTRTWAEDDLRRAVTAGQKAQLEREAQAAQQRAASLSQEVRIMQAQRQKMLTEQQTMRQETKALDIERR 181 Ralsto...
Q8XXF0                102 PAEAAYDMLARQTRAWAEDDVRHAVAAGQKAQLEREAQAAEQRAAALSQEVRAMQAQRQQMLEEQQAARRQTQALDAERH 181 Ralsto...
calssnu:BYI23_A020080 121 RAESIYAQFSRKSYELAYGEIRRMQLQAQKELLDRVIAKSADRANRLSADLALAQQQDSQVTQRQQQLQAESQALQTDKL 200 Burkho...
Q13Q61                143 AAEAAFHHFEEQATRLSDGETRRAQLEAQNEQLARMIARSEAQAERLRSELQRRGTQEQTVASRQHQVRKDVSQLEAQRV 222 Parabu...
Q2KX91                202 DLREQLRALQRQIDALQAEQM 222 Bordetella avium 197N
nioo:CFU_0864         192 AARNELRGLQNRIRTLEAQQT 212 Collimonas fungivorans Ter331
CAP43712              200 QLRKELSAMQRQIDALQAEQA 220 Bordetella petrii
Q7VX21                201 EVRSQLRAMQRQIDALQAEQA 221 Bordetella pertussis
jgi:Rpic_4257         230 AARARVDELQRQIRELEAQVN 250 Ralstonia pickettii 12J
Q8XQZ0                219 AARARLDELQRQIRSLEAQVN 239 Ralstonia solanacearum
jgi:Rpic_2366         182 AYQTQVESLQQQIRLLEKQLN 202 Ralstonia pickettii 12J
Q8XXF0                182 AYKTQIDSLQQQIRLLEKQLN 202 Ralstonia solanacearum
calssnu:BYI23_A020080 201 EAERKLRALQLQVEQLQRQSE 221 Burkholderia sp. YI23
Q13Q61                223 AAQAHLNKTHRQIHQLNLTSN 243 Paraburkholderia xenovorans LB400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap