Conserved Protein Domain Family
DUF2937

?
pfam11157: DUF2937 
Protein of unknown function (DUF2937)
This family of proteins with unknown function appears to be restricted to Proteobacteria.
Statistics
?
PSSM-Id: 337927
View PSSM: pfam11157
Aligned: 39 rows
Threshold Bit Score: 105.765
Threshold Setting Gi: 123378822
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81541491    2 FRSYLRLLLFTLGLLLGVQVPGFIDDYAKRVDAHRLEAAQNIQGFQQTAGQFFNgSLEELVRHYRSNSDPVFQRDGENLD 81
gi 122378412   2 ILRGFILAASVAGALGAAQFPAFSQQYLQRLGGAVDALQQVILDFDASAASLGL-SREEALAQMTGSA--FVQARRADMQ 78
gi 123378822   2 ITRMVTLLGGAGAGLGLSQFPAYAQAYLQRLGGHVDALRRTVAEFDADAAALGL-ERHAALVQLAQGGE-MGAARAETMA 79
gi 81627167   28 LDKFLDRFFVVLGAFLGSQIPEFLQQYVQRLAGHVDELKYIIDQLSQLASASNK-SLEQYIQKFVHSSDLDFVKQGEFMQ 106
gi 502947123   5 LFGLIDRFLVVAGALIFSQAPQFFSQYMHRLAGHVEELKIHIKTIQQAALKSGK-ELPEYLMKFSLHQDPDVSMQGQMMQ 83
gi 493384041   5 IGGIIDRLCVVSGALLFSQIPQFIQQYSQRLAGHVAELKIQATTLAEAAQFSGK-TIDQLISKFLTSGDLDFVHQGELMQ 83
gi 489703168   4 VVRTLGLAFGLLAAVIAAQAPEFAQQYTQRLGGALDELRRAIAALDADAKATGR-SRDEALALLRTNPDAFIARRGESAR 82
gi 503898642   2 LKRIVCLIGAALGGVTLSQTPEYTQQYTQRLSGAVDELTTIIEQFDADAARFGL-TRQEGLERYRASPDDFLEERGLSMQ 80
gi 501587712   2 LRSRLALFFGIVTGVAASQIPEYAQQYRQRLGGAIDELQTIVTTFDDDSARQGL-SEDEGIARLLASKDEFVSGRGVQMK 80
gi 501274099   4 vFRTFGLALGLLGGVVAAQAPEFAQQYAQRLGGAADELRRQVAVLELDAQATGT-TREGAVDRLRASPDQLVARRGEAAQ 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81541491   82 RLMRRARMLDAEWQAMQG--PWYARAWHMLRAPNHELLMETYASYSYQVLLKPEVIAWGLGCALLVAWIAELIVYSLASL 159
gi 122378412  79 QAFRRYDGLRAALDTLEGq-GPFMRAYHFAHLTDGEIVKGAWEAFEPALPITFASALFAGVGGVAGGISAALLAGLLRSR 157
gi 123378822  80 ATIDRYGRLSSDLHELSAm-APVERALHLGRFAEAEIASATLSAFEPAVAVSLDALLLAAIGALVGGGLIWGMMAGGRRV 158
gi 81627167  107 ALVTRWQNLNDSLRSLAQs-SYFERPFVFLKEMNYPIAQETFYSYQAGINLTLEGLGYTAIGIIVGILLYQLISKIFKFG 185
gi 502947123  84 GMLNRYADLNQSLSALLDs-TPLTRPFVFLQHFNFEIAKATAANFQPGVLLTVEGAAYAVLGMGIGYIVFRFIHAVVFFF 162
gi 493384041  84 QAMVRFHYLSTALSNLYTs-TALSRPFIFFSQIDMGIAEGTLENFTFGVSLTIEGGVYALIGMTTGALMYRALALLGRti 162
gi 489703168  83 ADVERLKRLEAQKLALDTaaSPLGRLSVMARDPDMSIARATYRDYQPAVPTTADGLVAGLLGFLAAWGGWRVTSDVGRHL 162
gi 503898642  81 TVFDRHARLSTQLADLRQa-PAGTQLFEIARHFDTDVGAAALEDFQPALPLSVVGFAYIAVGLAAGFAVFWVLASVLGAP 159
gi 501587712  81 DVSARLQKLTRSNEAMAQa-GPIGRLTALAADFDPLIARRAYASFEPAVPVTGEGFALGGLGFVAGFGVWQILSAPFRRR 159
gi 501274099  83 ADIARLARLSAQQQALAAatSPLGRVVAMLRDPDLPVAEAAYREFRPAVPTSADGLAAGLIGFFVAWGGWRVASDVGRRA 162

                 .
gi 81541491  160 F 160
gi 122378412 158 R 158
gi 123378822 159 L 159
gi 81627167  186 S 186
gi 502947123 163 F 163
gi 493384041 163 k 163
gi 489703168 163 a 163
gi 503898642 160 F 160
gi 501587712 160 g 160
gi 501274099 163 V 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap