Conserved Protein Domain Family
DUF2870

?
pfam11069: DUF2870 
Protein of unknown function (DUF2870)
This is a eukaryotic family of proteins with unknown function.
Statistics
?
Aligned: 43 rows
Threshold Bit Score: 113.495
Threshold Setting Gi: 225631836
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEN46286     189 ASLWFSGKEMHRGKNLRDYVGK-NEKTKIVAKIQKRGQGPPGREPVFSEEDKKQMMLH-AYRKQEEMKKLAEDNEDAYMN 266 Florida lancelet
3_pfamImport   1 VELWWAGKQFTRGKDVCDVVGK-NDKSTLIVTLQKQGDGVPRRQSVVRAEERDAVTALcSQEKQKRQQQVVKDDAEDYYK 79 
EJK76268     177 TAIWSCNKEFARGQPISHRVGT-NEKTKVIVKLATKGGGPPAREPIVSEAERNAMAAF-YFKRQEQLKELAKADEDDYLN 254 Thalassiosira o...
EED91061     261 ASLWTCNKEFIRGKLVSDRLGScNEKTKIVAKLTTKGSGPPAREPIVSEAERNAMTAF-YFKRQEELKKLSQADEDDYLN 339 Thalassiosira p...
2_pfamImport   1 AELWWAGKQFFRDQYVRDLVGK-NEKTKIIVKLQKKGGGMPSREPAVSEDERKAMMAY-YFKKQEEMKKVAEDDAEEYMT 78 
EEY68162     183 TELWWAGKQFFRDQHVCDLTGK-NEKSTLIVKLQKKGGGAPSREPGVSEEERKAMMAF-YFKKQQELQQAAEDDAEDYMK 260 Phytophthora in...
EAY04406     143 VQFWVTRKSYQRGKHIFDYTGK-NERQTFVAKFTGPESGPPPRDMTMDKEAQIRLMSQ-MHRKAEELKRIENDDDTSYLD 220 Trichomonas vag...
CAM72960     165 AVMWWSAKPLARDSDFVKYIGK-NDKTKITVKLAAEGSAAPPREPAVDAKAQAELMQH-FYRKQEEMKKLVEDEDISFGN 242 Leishmania infa...
CAM44124     203 AALWFCGKPM--EATLAKYCGR-NEKSKVIVKVAPRKGPAPSCEPRMRYEDQRALYHA-MCQRRETYKQL---DDSELRD 275 Leishmania braz...
Q383T3       180 AGLWFCGKLM--EDTIARYSGK-NEKSRLTVKVHPKDSVPPSTEPRISYDDQRALYER-MRTRREEYKGL---EESELRD 252 Trypanosoma brucei
EEN46286     267 -SDWADTGKLKQDLHGIRNV 285 Florida lancelet
3_pfamImport  80 iSPWADPSMLKNSLRGTDNI 99 
EJK76268     255 -SSWADPKGMKKALQGLDgg 273 Thalassiosira oceanica
EED91061     340 -SEWADPKGMKRNLQGLNDV 358 Thalassiosira pseudonana CCMP1335
2_pfamImport  79 -SAWADPKSLKNSLRGTNNI 97 
EEY68162     261 -SSWADPKALKNALRGTGNI 279 Phytophthora infestans T30-4
EAY04406     221 -SQWANPRGLKNTFQGLEDV 239 Trichomonas vaginalis G3
CAM72960     243 -SAWANPHGLKNQLQGLDSI 261 Leishmania infantum JPCM5
CAM44124     276 -RVVRQSRGAERLLLG-ATA 293 Leishmania braziliensis MHOM/BR/75/M2904
Q383T3       253 -RVVAQARGKVALTAPAAAS 271 Trypanosoma brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap