Conserved Protein Domain Family
DUF2861

?
pfam11060: DUF2861 
Protein of unknown function (DUF2861)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 314088
View PSSM: pfam11060
Aligned: 15 rows
Threshold Bit Score: 230.026
Threshold Setting Gi: 81398362
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81755619   23 WFEQNTPLTQAHQHLLEDNLPGMFESLVEVWQSSPTDTLKEHLNSLLIQSLNR-DCGKSL-TKKTLPN-WLTGVKVIRQT 99
gi 81725797   22 WFQTNTPLTQAHQHLLEDDLAGMFNSLVELWQTEPSKDLTPHLNDLLGQSLSK-NCGKSL-TGVTLPD-WISGVNVIRQT 98
gi 81543930   28 WFEKNTPLTQAHQHLLNNDLESMFSSLVEVWQLEKNKNLKTHLNNLLIQSLSV-DCGRGL-DNKPFPD-WIQGVTIRRVD 104
gi 81656315   19 pllpaTPLEPAYHALLSGDRAGAWRQLDALGAAMSSAAQRQAWLTLQRELASG-QCGR---DAPAAPPaWLGD--LELDL 92
gi 81544127   36 WFRT-TPLQSSYQLLVEGHPTQAWHEL--IHTLSTTPVAEPFWQPIKEAILSQtQCGQAL------PSaSLNDLAIAVTF 106
gi 81398362   22 WFAD-TPLQSSYSALSANQTLLAWQEL--QLSLSQNQISEHYWQPIKDTVLSKtQCGKQLiSLVNLPA------NIDVSF 92
gi 315181540  23 WFENNTPLTQAHQHLLNNDLESMFASLVEVWQLEHNKNIKSHLNDLLVQSLTV-DCGKGL-DSKPFPE-WIKSVLIRRID 99
gi 503633720  26 WFDQITPLTQAHQNLLNNNLEAMFNSLVEVWQLEHNKNIQSHLNELLLQSLTV-DCGKSL-DKKPLPE-WLKSITINRQE 102
gi 549797215  20 WFA-NTPLQDTYQALIEGHPEWAWQEL--HLALGNQALESQYWLPVKQEILNQtRCGLDLsERPVLEP-------IKIHF 89
gi 503634211  22 WFMA-TPLQSTYHALANHQPQLAWQEL--VLALNNQTIATPHWASVKHAIIEQtQCGQQL-LSDVVPN----AALIKVSI 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81755619  100 IQSPGRDTYRLVIDIRSNVEVKSLAVRKW-VDRSVSSDSVFT-EISGDGvTNGGDEKQYQKRyNLTGKLDSGLYQLVVQP 177
gi 81725797   99 IQSPGRDTFRLVIKLRATTDIEDISFRRW-VDESISGDSSFSyEEQADG-TEIANERSFLKRyNLTGKLEAGLYHLSVVS 176
gi 81543930  105 VQSPGRDAYQVAIDTKTKVPITDIRLTKW-VDKVVSTDSSLT--NRSDSvT--TNIYTYAQRyNLTNPLSAGLYRIDITA 179
gi 81656315   93 IQRDIPLSRVYNVRLNGVSPRRDLRWSLRlPDGRE--------LFAGAKtRYDGRQFELESE-DQAAALPPGVYRLTAQS 163
gi 81544127  107 IHKFNQTFQGYQVRLSAENLSQPLAVRLAsSQGAT--------LLAAEL--APADYAEVESR-DLLSPYAAGVYWLTLG- 174
gi 81398362   93 INKNSVNNQGYQIKISTEQVTQPLILKLFnENNTL--------LVTANIpQPTEEYIEFESN-DLLSTPKAGIYQLSIN- 162
gi 315181540 100 IQSPGRDAYQVLIDTKAKKAIADIRLTQW-VDKPLSNDSTFT-RTDRDNvTS--QNISYLKRyNLNTKLNMGLYRLDITA 175
gi 503633720 103 IQSPGRDAFHVDIEVDAEKPLADIRLAQW-VDKSLSTDSVLT-TTSSDSvTGKTHY---LKRyNLNSKITMGLYRLDITA 177
gi 549797215  90 IRRLGQTSAGFQIKVSAEQVKTNIPFSVIsPNGKR--------LIEGKLlTKEG-YQERESQ-EMLITPPSGIYQLELG- 158
gi 503634211  94 QKKTNVMQQGYQFKLSMEGAELPSQVELLgPDNSL--------LISQSQvTSSAPYIELESP-ELLFAPQDGVYRLTLD- 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81755619  178 AGQEVWSGWVILGEPIAPQYVRWSSKENWTVEKVALNNP-----YCPLPEMNVGLYDYVDGQYQRVWNKTY--------- 243
gi 81725797  177 KDKQVYRTWVILGDSNSSQYVRWTSKENWKVEKSALRNP-----HCPLPQLEVGLYDYVDGQYEQMWKKTY--------- 242
gi 81543930  180 ADQESWSAWVIFGDTIAKQVVRWTSKDEWQIQKTELLNS-----HCPLPKLSISVFDHIDGNYKQIWSESY--------- 245
gi 81656315  164 GGE-TWRQDLSLPGMAAQD---WLRRDG----RKLAPRPptqpsACPRPWLEQALLSQPD--FELRWWQ----------- 222
gi 81544127  175 ----EQRMALLISAPSSTP---WIEQSS---AADLTIRFpatpsGCASSLAR---WQFFDQNFTLLHSQTVn-------- 233
gi 81398362  163 ----NVRYPLVVSSFTNTT---WVQQSTDQTSKSFIVTPpankiACAPVVMN---WQWFDEQYNQLGRHIPmqltpvmpv 232
gi 315181540 176 NDQESWSAWVIFGEPKAKQTVRWASKDQWVVEKNALLNR-----FCPLPKLGVSVFDYVDGKYKEIWNQSY--------- 241
gi 503633720 178 KDQQSWSAWIVLGEPKAKQIVRWASKDQWQIEKKALLNP-----YCPLPELNVSLYDYIDGKYSEIWSQRY--------- 243
gi 549797215 159 ----SVSYPLIISLSNDNP---WLALSK-NAKPKLVLTMpetpnNCVNAFAS---WQWFDSQYQQLGRIIPig------- 220
gi 503634211 164 ----KQHYWLVLTMPFGST---WLQSASPNGGYPLAIESpialtNCPPTSLA---WQWFDDQFQLIKQQDMvai------ 227
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 81755619  244 ---------ESDYPNSLELEGIPNERYVLAVSMNTKRWQGEILVEQSQTISRTYD 289
gi 81725797  243 ---------ESNYPNSLELAGVPNDRYVLAVSINSRRWQGDIIVEQAQTISRTYD 288
gi 81543930  246 ---------ESDYPTTLDNVSLPSDRYIVTVSMIHQRWQGPLAIEQSQVISKTYD 291
gi 81656315  223 ---------RRELGQTLRWPANPGEKLWASVSLLRAEFRGPIAVRQIHRVAAPLs 268
gi 81544127  234 ---------RDQHPAP---PIAPSQARWRSLSVIQSEYQGTIRVEQMQRLTIPID 276
gi 81398362  233 tsaptdrnlQYEAKRP---ATTPSNATWLSAVVSQFEYQGELKVEYVQRFSLPIS 284
gi 315181540 242 ---------ESDYPTSLELNNLPSDRYVLAVSMTHQRWQGPITIEQSQVISKTYD 287
gi 503633720 244 ---------ESEYPNELEITNLAADRYVLAVSMTQQRWQGPIIIEQSQVISKTYD 289
gi 549797215 221 -------dkTADIPRP---HHESNGAEYLSASVKVREYQNGIAIDYVHRMSIPYt 265
gi 503634211 228 ------sntQQLLDKPSSSPSS---AKWLSTLIKTIEYQGAIKVEYVQRLTLPnq 273
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap