Conserved Protein Domain Family
DUF2740

?
pfam10872: DUF2740 
Protein of unknown function (DUF2740)
This family of proteins with unknown function has a highly conserved sequence.
Statistics
?
PSSM-Id: 287804
View PSSM: pfam10872
Aligned: 2 rows
Threshold Bit Score: 75.5038
Threshold Setting Gi: 9911042
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40
              ....*....|....*....|....*....|....*....|....*...
gi 9911042  1 MPKQLSPDQDKLHKNILRDRFLSSFKQPGRFRAELEKVKLILKRKGHE 48
gi 9911042  1 MPKQLSPDQDKLHKNILRDRFLSSFKQPGRFRAELEKVKLILKRKGHE 48
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap