Conserved Protein Domain Family
DUF2572

?
pfam10833: DUF2572 
Protein of unknown function (DUF2572)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 287769
View PSSM: pfam10833
Aligned: 7 rows
Threshold Bit Score: 241.57
Threshold Setting Gi: 503511258
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9CM74         5 KGMVTFVILVLLSSGLTILMLLNDDILHWHLSALHQRKLDVQQMLVLQRQNEEKKQHLCKH----ISSTSSENRQQVTFR 80  Pasteurella mul...
Q65UM7         6 RGFATLMIVFIIAGLAVSTMLFTDDQLHYHRGIMAQRSAYVSQMAQLQNLAIEQMPVICQQipdgLPDNTTSYTLPISLS 85  Mannheimia succ...
P44081         5 KGIITLTILIFISGLLTAFLLLDDSHLSFFRAQQNQRKHYVERTLQLQKMTATKKQTACLD----LPLNNNESVKQISIA 80  Haemophilus inf...
WP_012073516   7 rgimtltllmllsvmllIFMLFDDDAIRLHSSLASLRQIYVSHNIELQQISQQQKRTACSE----VPLNSTATVTRVAFE 82  Actinobacillus ...
WP_011608420   5 kgvvtltllmllssvllillFFDGDLISLHSSIVSQRKIYLEQSLILQRQSISQKEKLCEN----QPLNNNLKSLKIEFE 80  Histophilus somni
WP_013745822   6 nGYLNLLTLLFINALVLLLLLVTEDDLSLYRQNLSVRQDYALQQAQLYQQYQQQYAAFCQS----NHTDRLNYTERLSTE 81  Gallibacterium ...
WP_005545593   6 RGMMTMSLLLLLSAFLLLTMLFNDDLLRLYSAIAGQRNLYVEQQVKLLSLSQSTQRERCEQ----VPIDENGDVFLVQFS 81  Aggregatibacter...
Q9CM74        81 -----LVEG---KANYVWCICRTLFKAQPRQALNigKLAYFIQREYRGLFSHQFSV-------QHAPYFYWFDTKQTSWT 145 Pasteurella mul...
Q65UM7        86 ta--sSNKSaveISHFLRCRRYSLLATKPTKKFE--SYSTAVNEENIELFRHRFNQsyinedtGQKVFLYWLDETTESLI 161 Mannheimia succ...
P44081        81 le--gSTDA---IQYFLWCERMSLFKKSPKKGDNqgALKDFVTDEKLAYFRPHFSSpprilnaNKMPKLYWFSDSQAEVE 155 Haemophilus inf...
WP_012073516  83 qa--gFSDS---NRHYIWCRRSALFKQSPKKGINegRFSEMINEESVSLFQGKFGLpnd-lvqEQSDYLYWLDKNQTEWT 156 Actinobacillus ...
WP_011608420  81 sr--rKIDR---TSQFIWCERKYLFKKRPKKATYeaGLSQYINLELLDLFQHKLHSppailprDKANYLYWVEEKSAELE 155 Histophilus somni
WP_013745822  82 ey--sYGNG---INHFIDCERQQIFVQEPKKSLNs-PLKEYFN------INYPLSTpsienasATEPQIWKVE--QNEIT 147 Gallibacterium ...
WP_005545593  82 legtpFPDG---IRHHIWCQRDKLFQKSPVRNLHegLLAQFIAESGLMIFREQLSGppknsvrKQPPSLYWFNADETEWT 158 Aggregatibacter...
Q9CM74       146 LTQNIEAIIIAEGDLHIHGKGKIKGTIVTGGRLTLEpSVQVSYHKATVAYWVTQLRDWQLAEKSWHDFL 214 Pasteurella multocida
Q65UM7       162 LSGDTNAVVIAKEPLKIEGKGRLRGVVISDYPVELE-GVQLSYNKYVMDFIYREFSLWKLAERSWSDFD 229 Mannheimia succiniciproduc...
P44081       156 INGTVSAVLIAEGDLKLTGKGRISGAVITSGNLTLD-GVTLAYGKKTVVALVQQYSQWQLAEKSWSDFN 223 Haemophilus influenzae Rd ...
WP_012073516 157 IAGDIYGIIVAEGNLHIAGKGRIRGAVISGGAISTDeKVSIAYRKATVTNLVQLYSQWQRAEKTWHDFT 225 Actinobacillus succinogenes
WP_011608420 156 IQGNINAVVIAEGDLKLTGKGKISGTVITGGKLSIEpAVKIVYRSKTIIDLIRSYSYWQFAENSWYDFQ 224 Histophilus somni
WP_013745822 148 LDQDFYGVIVALNDLQISGQGTIFGAIIYERGLRYSeNIKIVFDVEIIQNLSKRYSSWKM-RGGWRDFg 215 Gallibacterium anatis
WP_005545593 159 LDKNVNAVIVAEGDLHIRGKGKISGSVITKGKLTLDeDIKVTYSKSTVAHIVQQYSRWRLAENSWYDFA 227 Aggregatibacter actinomyce...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap