Conserved Protein Domain Family
DUF2527

?
pfam10736: DUF2527 
Protein of unknown function (DUF2627)
This family of proteins with unknown function appears to be restricted to a family of Enterobacterial proteins. It has a highly conserved sequence.
Statistics
?
Aligned: 2 rows
Threshold Bit Score: 53.9882
Threshold Setting Gi: 122368696
Created: 23-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0WG43  1 MCGIFSKEVLSKDVSVEYRFSADPYLSASSSNDSSLSM 38  Yersinia pestis
P64508  1 MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSM 38  Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap