Conserved Protein Domain Family
DUF2525

?
pfam10733: DUF2525 
Protein of unknown function (DUF2525)
This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. The family has a highly conserved sequence.
Statistics
?
PSSM-Id: 313852
View PSSM: pfam10733
Aligned: 7 rows
Threshold Bit Score: 84.0633
Threshold Setting Gi: 156531682
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P64519       18 DVDALLAAINEISESEVHR--SQNDSEHVSVDGREYHTWRELADAFELDIHDFSVSEVNR 75  Escherichia coli K-12
WP_002440091 19 DVDALLAAINEICESEIEPaiSDDDPQRVTIGGTRYHTLTELAEAFELDIRDFSTLECNR 78  Shimwellia blattae
WP_010618652 18 DVDALLEAIQKKTSGEVQEfmQAEDAHRVKVNGEAFDSYTELADAFELDIRDFTITEVNR 77  Plautia stali symbiont
WP_013202690 18 DVEALLEAIQDRSSGEVKEfmDNDRAHKIRVDGREYRSYTELADAFELDIRDFTVSEVNR 77  Erwinia billingiae
WP_025421840 18 DVDALLNAVADITGETVQEheDNQEAHMVTVQGRQYTTFGELAEAYELDIRDFTVNEVNn 77  Sodalis sp. HS1
ESM53958     24 NVDALLAAINEISESEVHR--TLDDPQRASIDGRGSHTWRELAEAFELDIHDFSASEANR 81  Klebsiella pneumoniae BWH 28
AKE95527     22 DIDALLGAIEVISEDERH---TPECVSPTLADARRKDTCRELGEEFELDIRDAGPSEVNH 78  Cronobacter sakazakii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap