Conserved Protein Domain Family
DUF2525

?
pfam10733: DUF2525 
Protein of unknown function (DUF2525)
This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. The family has a highly conserved sequence.
Statistics
?
PSSM-Id: 313852
View PSSM: pfam10733
Aligned: 7 rows
Threshold Bit Score: 82.5225
Threshold Setting Gi: 816222139
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 54042847  18 DVDALLAAINEISESEVHR--SQNDSEHVSVDGREYHTWRELADAFELDIHDFSVSEVNR 75
gi 488370706 19 DVDALLAAINEICESEIEPaiSDDDPQRVTIGGTRYHTLTELAEAFELDIRDFSTLECNR 78
gi 498304496 18 DVDALLEAIQKKTSGEVQEfmQAEDAHRVKVNGEAFDSYTELADAFELDIRDFTITEVNR 77
gi 502967714 18 DVEALLEAIQDRSSGEVKEfmDNDRAHKIRVDGREYRSYTELADAFELDIRDFTVSEVNR 77
gi 645050559 18 DVDALLNAVADITGETVQEheDNQEAHMVTVQGRQYTTFGELAEAYELDIRDFTVNEVNn 77
gi 555110954 24 NVDALLAAINEISESEVHR--TLDDPQRASIDGRGSHTWRELAEAFELDIHDFSASEANR 81
gi 816222139 22 DIDALLGAIEVISEDERH---TPECVSPTLADARRKDTCRELGEEFELDIRDAGPSEVNH 78
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap