Conserved Protein Domain Family
DUF2487

?
pfam10673: DUF2487 
Protein of unknown function (DUF2487)
This is a bacterial family of uncharacterized proteins.
Statistics
?
PSSM-Id: 313809
View PSSM: pfam10673
Aligned: 21 rows
Threshold Bit Score: 157.432
Threshold Setting Gi: 506361757
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81787097    9 DVYLQEQEYIDTAVLSLLPVSFAEDKKSRLEQFEFAYTLSNEVEKQFKGRIVQFPSFTYHVSEEQEQAVERLQEWLDDLN 88
gi 81366215    9 DTYLKAADYVDTALIPLMKTTWDTEVKTVTQAVEFTAQLADEMERQFHGRIMQFPAFTYAQSEPLSSRIDRLLGWAADLK 88
gi 81582867    9 EQFEQAREYVDTGVIPLLSISAAKEMKTVVEQGEFIELLSMELEREYKGRVLLLPAFTYLVESQKNEKG-RLQEWTNHLQ 87
gi 1730924     9 KDYLQAKDYIDTAVIPLINIRVNNHFKMAAEKGEFTQLLSEELERQLKGRVYLLPPYTYVDRNEITVQ--GLKDLREELI 86
gi 81385228    9 DVYLNAKEYIDTAVIPLISVDLGDQFKSAVSKGEFTSILAEELERQLKGRIYLFPPCTYLEADEKSAQ--HIADLKEMAE 86
gi 503253825   9 DTYLNAKEYVDTAIIPLIPIEWRSDLKGKVSMAEFTTLIVEELERQFKGRVFQILPFTYLSEESEEERVARLKKWDQHLY 88
gi 502723531   9 DKYLQSKEYVDTAIVPLIPISWQKEIKSTVAMGEFISIITQELERQFQGRVVLFPAFTYLETENAEERTLRLKRWSEELK 88
gi 493363034   9 DMYQQAKEYVDTALVPCIPIG-STNMKAFAEMSEHTLLVTNEVERQFKGRVMLFPPLTYFVQEQIQA---RVQEWTNMLK 84
gi 501339025   9 QRTRNEQAYIDTLIVPLIPVGFDEAMHAFSECADMTMTVATEVERQLSGRAMLVPAMTYIGEPSID----QLTSWQQAAS 84
gi 506361757   9 lrsiAERQYVDTLIVPLAELAFGEDMVRKAESYEVIHAVTAETERQLSGRTMLSPTISYTDVEAGVK---LAQDVVAKAN 85
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 81787097   89 TLGMKHIFLITSDSNWKGYEKtceeNV-ELVWVPSIPLAHLDGQVKHKIIQDQLNQLIPIMTKKW 152
gi 81366215   89 AASFSHICLLTADGEWKTAENe--lDEmALFFVPALPLEFVEAKHRKEVMDGQLKQLIPFLSQLW 151
gi 81582867   88 KQGFKHIAYVTSDFSWKEDMQe--lQG-DLFWFPSLALEQFSDQAKREVIHAHIKNVMVMLEEKW 149
gi 1730924    87 TE-FPHVVLLTSDESWRAEDAl-----gKMIVTSSVPLEHLNDSLKRKILDERTAEILNVLLQLW 145
gi 81385228   87 KH-FRHIVFLTTDERWKQMLDse----qKLLWVPAIPLEHMKDSLKQKLLEDQIEQILNILLQYW 146
gi 503253825  89 SGGFKHVVYITADGEWKKVEKe--lPD-MLIWLPSLSLENMDESYAKEIIGQQMKQLLPLITNKW 150
gi 502723531  89 LGGMEHIVYATSDGFWKTVEEe--lGE-WLIWLPSIPLEHLSSENRREVIGGQIKQLVPIMTNKW 150
gi 493363034  85 QAGFQHVCFITSHA------Di--aDE-TFVYVPALPLEHADDTYKQKVVRQQVEQVMDALVAKW 140
gi 501339025  85 SEQFRFVTFITADLRWKETSVt------DIIYVPRLSLETMSRDQQGQMVGNFVGQVLEQLGNRW 143
gi 506361757  86 SSGFSHVLFIASDVRFKAFDL-------PVLFVPPLALGSMSSDQAHTMVQNFATQVITELSSRW 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap