Conserved Protein Domain Family
PduV-EutP

?
pfam10662: PduV-EutP 
Ethanolamine utilisation - propanediol utilisation
Members of this family function in ethanolamine and propanediol degradation pathways. PduV may be involved in the association of the bacterial microcompartments (BMCs) to filaments.
Statistics
?
Aligned: 16 rows
Threshold Bit Score: 212.131
Threshold Setting Gi: 122480483
Created: 23-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8XLZ6         1 MGRVIFMGKTGCGKTTLCQALNNLEIKYKKTQAIELYDNAIDTPGEYMENRGYYTALIVTAADADIIALVYDCTSEENYI 80  Clostridium per...
Q834L1         1 MKRIILMGAIGCGKTTLCQALQGKELIYDKTQAVEFHTEMIDTPGEFILHRQYYNALNVTAAEADVIGLVQSAVETQQVF 80  Enterococcus fa...
Q9XDM6         1 MKRLMFIGPSQCGKTSLTQSLRGEALHYKKTQAIEWSPMAIDTPGEYLENRCLYSALLTSACEADVIALVLNADAQWSPF 80  Salmonella ente...
Q24MI7         3 DSKILLIGGVGTGKTTLKQALSDLPLIYQKTQALNFSEVFIDCPGEYLEIPRYYHVIIDLSHQVSEIWALQDATKTYLTY 82  Desulfitobacter...
WP_012131755   1 MKRIMLIGPSQCGKTSLTQSLNGEALHYQKTQAIVWSPGTIDTPGEYLENRCLYSALLASACEADIIALVLNADAPWSPF 80  Enterobacteriaceae
WP_015958923   1 MKRLMLIGPSQCGKTSLTQVLRGETLRYQKTQAIVWTPAAIDTPGEYLENRCLYSALLTSVCEADVIALVLNADAPWSPF 80  Klebsiella pneu...
WP_011836561   1 MKKIMFVGPVGVGKTTLTQRLKGLELSYFKTQAIEFYDAIIDTPGEFLQHRKYYNALNVTATEADVIGLLVAASNQMQTF 80  Streptococcus s...
WP_012103747   1 MRKIILFGRSGCGKTTLTQALRGQDIVYHKTQYINHYDAVIDTPGEYAENRSLGSALAIYSYEADVVGLLLSAIEPYSIF 80  Clostridium klu...
WP_012158655   1 MKKIMLIGSVGSGKTTLCQRIQGESIKYKKTQSVEFYSQMIDTPGEFVLHRRFYSALQMMAASSDVIGFVCSVVESGQTF 80  Alkaliphilus or...
WP_117592504   1 MKKVFLMGRSEAGKTSLTQALKGEELHYHKTQYTNSNEDTIDSPGEYAESKHFSVGLACFSFEADVVAIVQAADEPFNLF 80  Blautia obeum
Q8XLZ6        81 APGFASMFCKEVIGIITKINLAkDKSEIEVAEERLNLAGVSKI-FKVDTVDDVGIKELFNYLNK 143 Clostridium perfringens
Q834L1        81 SPGFGSIFPKEIIGILTKIDLAqDSQQLEIVRQQLKSAGATRI-FEISSVEKIGLQELVDYLEE 143 Enterococcus faecalis
Q9XDM6        81 SPGFTAPMNRPTIGLVTKADLA-EPQRISLVAEWLTQAGAQQI-FITSALNNSGLDAVLDFLNs 142 Salmonella enterica subsp. ente...
Q24MI7        83 PPKFVRVFRKPVIGVITKIDLP--QANLEAARSFLNNAGIAQPfYEISALHKKNIQILRTRIEC 144 Desulfitobacterium hafniense Y51
WP_012131755  81 SPGFTGPMNRPVIGIVTKSDLA-DSSRISCVENWLIQAGAQKI-FVTSALMKSGIDEMFVFLSA 142 Enterobacteriaceae
WP_015958923  81 SPGFTAPMNRPVIGVITKADLA-APPRLQQVRTWLETAGAGHI-FITSALTGDGLDDLFACLNA 142 Klebsiella pneumoniae
WP_011836561  81 PQGFSSLFNKEVIGIVTKIDMAdKEEQIEKARRQLKAAGAKEI-FEISATENEGIDRLQAYLEA 143 Streptococcus sanguinis
WP_012103747  81 PPNIAPCVNREVVGIVTQIDRSd--ANANQAEYWLKLAGCKTI-FRVSSYTREGIGKVLNHLRE 141 Clostridium kluyveri
WP_012158655  81 SPYFAQNFTKQCVGIITKIDLApNEEAIINAEKRLELAGVSKI-FRLSAMKDEGVAELIDYLSK 143 Alkaliphilus oremlandii
WP_117592504  81 SDGSRCFLLRPLIGIITKVDSP--YANLPMVRQWMQNMGCEHI-FEVNNVTREGIPELMAYLQd 141 Blautia obeum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap