4LCT


Conserved Protein Domain Family
RPN7

?
pfam10602: RPN7 
Click on image for an interactive view with Cn3D
26S proteasome subunit RPN7
RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins.
Statistics
?
PSSM-Id: 313757
View PSSM: pfam10602
Aligned: 58 rows
Threshold Bit Score: 110.743
Threshold Setting Gi: 159107706
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LCT_B        73 DLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIR-TRDYCTTTKHIIHMCMNA 151 thale cress
Q8WQ58        63 EPEWKKKIGYSLFEQVKALETEIQ---STYGDEERAKLLYKLSDIHEEHGEYSKAIKNVLQ-AVESLKNKMMCAEGYYRL 138 Entamoeba histo...
O94308        77 DVEWVESVTFHRKQNLEQLRRELKAYKNNLIRESIRAAQLDLASFFADVGQFDSALRSYAK-VREYCTNAGQIAHLSLEL 155 Schizosaccharom...
Q2HA08        86 DQDWLQAREEENKVETNRLLKELKGYKNNLIKESIRMGNEDLAKHLESIGDLNAASETFSK-MRPDVSTAKQLIDVSKHL 164 Chaetomium glob...
Q7RXQ1        80 DKAWMESKEKENRDTTAHLQAELQGYKNNLIKESIRMGNEDLGKHFEAIGDVEAAMDSFWK-MRTEVSSTEQLVDLGKLL 158 Neurospora cras...
Q5KHC7       133 DERWINETRDTVAKEVSRLDVELRGYMSNLIKESIRLTQLAFAELAFKVGKVREALNYYAA-TREYSSTPQHHVDLGVGV 211 Cryptococcus ne...
XP_002638604 160 DTKWVDETSGSWQVALDHLQIEYKRHKDEGVKESTRRAMEDLFRHFLVAGKTEEAIRLYSRgIRDYCTQLKHSINMWMNW 239 Caenorhabditis ...
XP_001586570  80 DDQWIDATNKSNAAEAARLEAQLKGYKNNLIKESTRMGNEDLGKHYEATGQLALAFDAYSR-MRQDISIPRHVIDVCKHI 158 Sclerotinia scl...
XP_001542604  41 KVVRVE-------AKGFILVQSRQSSIWSPISAIIKMGNEDLGHHYHLIGDLPSASKAYSR-MREYCTTTSHIGSMLFRN 112 Ajellomyces cap...
XP_001276598 120 DTKWVDHMQKVVKAETDRLEHELRGYKNNLIKESIRMGNEDLGQHYHQIGNLVAASKAYSR-MRDYCTTPSHIASMLFKI 198 Aspergillus cla...
4LCT_B       152 ILVSIEMGQFTHVTSYVNKAEQNPETLE----------------------------------PMVNAKLRCASGLAHLEL 197 thale cress
Q8WQ58       139 VRLNIFNENFHQATNFLNKLQSLDAFTGn---------------------------------LYTKF-INIISFLLAIRN 184 Entamoeba histo...
O94308       156 MRISIWIGNYSHVLAFGSRAKSTVSAA-----------------------------------MELTSPIYAYCGLANFCL 200 Schizosaccharom...
Q2HA08       165 VRVCIQRREWDMVSAHLSKIGGAQSADEe---------------------------------KAVQPYLKIAYGIAFLGR 211 Chaetomium glob...
Q7RXQ1       159 VRVAIERRDWKSIGNHLKPLNSVNDSDPk--------------------------------aKALKTYSKIANGIAALGQ 206 Neurospora cras...
Q5KHC7       212 VETCLAFNYPAPLSGHIAKLETTLDRLHppphtqskqqaglsttasdlrerqaeesrsqaarRSVMVRAKVGKGLISASQ 291 Cryptococcus ne...
XP_002638604 240 IEVSICGNDWGKLESITSTAFRSLKDADdaeknnqqqqrgenatylvnqsapmtspsnrqliETALAKCQAAQVILKLRN 319 Caenorhabditis ...
XP_001586570 159 IEVSIERKEYIAVLSNVQKMRGTSVGPYd--------------------------------dQDVKPFCHVAEGIAQMHA 206 Sclerotinia scl...
XP_001542604 113 IHVAIDRGDWLGVQSNVQRLRNLQFKPEd--------------------------------eAKNKAKMFAALGLSQLAS 160 Ajellomyces cap...
XP_001276598 199 INVAIERGDWLSVQSNVHRLRNLQSKPEe--------------------------------qAKNQPKMSAALGLSQLHS 246 Aspergillus cla...
4LCT_B       198 KKYKLAARKFLDVNPELGns----yNEVIAPQDIATYGGLCALASFDRSELKQK 247 thale cress
Q8WQ58       185 TETFITAFELLDKVTTFDekdnwefGEFLSFQDIAIYGTLIGL-------LTQK 231 Entamoeba histolytica
O94308       201 GDYEEALAHFLKVETDTS-------DGIITKTDISVYISLCALACWDHKRLIQE 247 Schizosaccharomyces pombe 972h-
Q2HA08       212 GRFKDAALSFLSADSSIPss---tyGELASQSDVAIYGGLLALASMDRAELQST 262 Chaetomium globosum CBS 148.51
Q7RXQ1       207 ERYKEAAFCFVEASSGVPpe---iyNQIASPNDVAIYGGLLALATMDRHELQAN 257 Neurospora crassa OR74A
Q5KHC7       292 KDWARAGRELGWIEEDEGglg-dweGKAISTSDLALLSAFYVLASSDRSRIRRV 344 Cryptococcus neoformans
XP_002638604 320 HRYSDVLETVLVIKTECld-----sKWYVTSSDLGIYSVLCAMATLGRTNLKKL 368 Caenorhabditis briggsae
XP_001586570 207 GQYAMAAQTFLQVPPGFAgs----yYTIVTANDVAVYGGLCALATIERNDLQKL 256 Sclerotinia sclerotiorum 1980 UF-70
XP_001542604 161 SAYHSAAINFLSTDPILAdn----yKEVISANDIAVYGGLCALASMDRADLQTH 210 Ajellomyces capsulatus NAm1
XP_001276598 247 GSYLEAANCFLSTDPSLGds----yNEVLTSNDVAVYGGLCALASMDRNELQRR 296 Aspergillus clavatus NRRL 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap