2DO7,3TDU,1IUY,3O6B,3DPL


Conserved Protein Domain Family
Cullin_Nedd8

?
pfam10557: Cullin_Nedd8 
Click on image for an interactive view with Cn3D
Cullin protein neddylation domain
This is the neddylation site of cullin proteins which are a family of structurally related proteins containing an evolutionarily conserved cullin domain. With the exception of APC2, each member of the cullin family is modified by Nedd8 and several cullins function in Ubiquitin-dependent proteolysis, a process in which the 26S proteasome recognizes and subsequently degrades a target protein tagged with K48-linked poly-ubiquitin chains. Cullins are molecular scaffolds responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis. Nedd8/Rub1 is a small ubiquitin-like protein, which was originally found to be conjugated to Cdc53, a cullin component of the SCF (Skp1-Cdc53/CUL1-F-box protein) E3 Ub ligase complex in Saccharomyces cerevisiae, and Nedd8 modification has now emerged as a regulatory pathway of fundamental importance for cell cycle control and for embryogenesis in metazoans. The only identified Nedd8 substrates are cullins. Neddylation results in covalent conjugation of a Nedd8 moiety onto a conserved cullin lysine residue.
Statistics
?
PSSM-Id: 337788
View PSSM: pfam10557
Aligned: 399 rows
Threshold Bit Score: 43.9776
Threshold Setting Gi: 123476926
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DO7_A        29 QYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLK--FPVKPADLKKRIESLIDRDYMERDKE 86  human
XP_009014027 683 KIYLQAAIVRIMKARKVFKHNLLVKEVISQSLskFTPSISLIKKSIETLIDKQYIERTPN 742 Helobdella robusta
XP_001946605 670 KTYLQAAIVRIMKSRKILRHNQLVNEILSQSQt-FAPSIALIKKSIETLIDKGYLERTPN 728 pea aphid
XP_002127386 668 KLYLQAAIVRIMKARKVLHHNTLMEEVINKSRirFTPSVSAIKRSIEALIEKSYIERSPD 727 vase tunicate
XP_008944664  36 KMYLQAAIVRIMKARKVLRHNALIQEVISQSRarFNPSISMIKKCIEVLIDKQYIERSQA 95  Merops nubicus
JAT84753      56 KMYLQAALVRIMKQRKVLRHTELIQEVVAQARgsFAPSVAMIKKCIEALIDKQYLERApg 115 pink bollworm
XP_015787941 703 KLFLQAAVVRIMKARKAMKHNQLIQEVIDQAKnrFAPSIPMVKKCIEALIEKQYLERTSS 762 two-spotted spider mite
AAW27556     153 RYFIQAAIVRILKARRQIKHAQLIETILQQASnrFQPPIPLIKRCIEGLIDTGYLERNPD 212 Schistosoma japonicum
XP_009167894 826 RYFIQAAIVRVMKSRKQIDHVSLIKSVFQQASgrFQPSIPLIKRCVETLIDKGYIERSPY 885 Opisthorchis viverrini
CDS27998     738 KFFIQAAIVRILKARKTISHAELLKCVIEEAKerFKPPVLLVKRCVEDLIEKGYLERNPN 797 Hymenolepis microstoma
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap