1GAX


Conserved Protein Domain Family
Val_tRNA-synt_C

?
pfam10458: Val_tRNA-synt_C 
Click on image for an interactive view with Cn3D
Valyl tRNA synthetase tRNA binding arm
This domain is found at the C-terminus of Valyl tRNA synthetases.
Statistics
?
PSSM-Id: 378437
View PSSM: pfam10458
Aligned: 26 rows
Threshold Bit Score: 68.8164
Threshold Setting Gi: 148566424
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GAX_A          797 DVEEWRRRQEKRLKELLALAERSQRKLASPGFREKAPKEVVEAEEARLKENLEQAERIREALSQIG 862  Thermus thermophilus HB8
wustl:cce_4258  844 DIASLRAKLEKNLGKVEAEIKSLSGRLNNPGFVNKAPEAVVQGARDSLAEAEKQAEILRERLKRLQ 909  Cyanothece sp. ATCC 51142
Q7TUI9          864 DLDALRGRLEKDLAKAEKEIAGLAGRLANPNFAIKAPPNVVEECQSNLAEAEAQAELARQRLSDLG 929  Prochlorococcus marinus s...
Q46IA7          868 DIASLRSRLEKDLNKAQKEIESLSGRLANKNFVDKAPKDVVEECRANLTESEAQVRLVKERLMGLD 933  Prochlorococcus marinus s...
Q7UZI3          853 NLEALKDRLTKDLKKVNSDIETLNKRISNKNFIDKAPKEIVDECFAKLKEGNLQSEIINKKLKLLK 918  Prochlorococcus marinus s...
Q39X26          819 DVEEEEKRLLKEIGKLDKDIEFLAKKLANPSFVERAPADVVAKEREKLTEFSQKKEVLLASLDKIR 884  Geobacter metallireducens...
Q3AF87          810 DLEKEKERLNKELKKVLAEIERLNQKLNNPGFLAKAPAEVVNKEREKLTAFYREKEVLEQR---IG 872  Carboxydothermus hydrogen...
Q8EZT8          816 DVAKEKTRLEKELQKSELEKEKLEIKLSNPGFLSKAAPEVVEKERDKLKTLIDKVEVLKKGIQNLA 881  Leptospira interrogans se...
Q2RL27          814 DLEKEQARLEKELQKARAELEKVEKKLARPDFRAKAPAAIVAKEEARAAELKSTITALTKRLSYLG 879  Moorella thermoacetica AT...
jgi:RoseRS_0129 836 DLEAERARLLKDLEAALAEAARREARLATPGFVEKAPATVVQRERDGLAAVRETIARLQDRLAQQg 901  Roseiflexus sp. RS-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap