5IBY


Conserved Protein Domain Family
Lip_prot_lig_C

?
pfam10437: Lip_prot_lig_C 
Click on image for an interactive view with Cn3D
Bacterial lipoate protein ligase C-terminus
This is the C-terminal domain of a bacterial lipoate protein ligase. There is no conservation between this C-terminus and that of vertebrate lipoate protein ligase C-termini, but both are associated with the domain BPL_LipA_LipB pfam03099, further upstream. This domain is required for adenylation of lipoic acid by lipoate protein ligases. The domain is not required for transfer of lipoic acid from the adenylate to the lipoyl domain. Upon adenylation, this domain rotates 180 degrees away from the active site cleft. Therefore, the domain does not interact with the lipoyl domain during transfer.
Statistics
?
PSSM-Id: 378435
View PSSM: pfam10437
Aligned: 240 rows
Threshold Bit Score: 39.3678
Threshold Setting Gi: 122268808
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IBY_A          267 SPAFNLERRHRFPIGSIEMKMNVADGAIQEIKIFGDFFGLGEIKDVEDILTGVKYDKASLEEAIDQID-VKKYFG--NIE 343 Enterococcus...
jgi:Theba_1953  250 NPEFNFRASKRFQWGGIELLFTSRKGKIVDVTVYSDSMDVDFIEELRRGLKNIEFSRSSILKALNNLPr--------YIE 321 Mesotoga pri...
jgi:Hore_05080  245 TPEFDIKLVNRFDWGGIELNLALKNGVITESTIYSDAMESDLIRKIASSLKGVPFRFGDINNRLTGLK-----EEegKNI 319 Halothermoth...
Q24WR1          244 TPQFDLVLETRFPWGGIELGFTLRQGKIIDSTIYSDAMNAHLIQEISASFLNRTLNSSELLLALESLQ-VQEEd---LMI 319 Desulfitobac...
jgi:Desdi_1987  245 TPQFDLVLETRFPWGGIELGLRLNKGCITESTIYSDAMNAALIQEISDCFLGKPFNGEELALVLDAVK-VQAEd---QLV 320 Desulfitobac...
jgi:Desmer_1647 246 TPNFDMVLSTRFPWGGIELGLTLANGLIKDAKIYSDAMNSHLIDRIALTLLKLPLQIDLIVNAIRGIN-VDQEd---QVI 321 Desulfosporo...
jgi:Acear_0639  247 TPDCDISIDNHFTWGEVEINLKLANGYIEQATIYSDAMYSDLIEQISVALEERPFKLKVILATVEDVFaNYQFPT--KIN 324 Acetohalobiu...
WP_022133536    243 kIKFSWEANERFDWGEIQMQLHINEGIIQDALLYSDALDADWIELLSQKLIGCRFEPEYIFLKLQKL----SFNQtqNQI 318 Negativibaci...
CDA61814        243 kiPFTWLREERFDWGEIQLQLNIDNGIIEDAALYSDSLDERFIERIAPCLKGCRFEPDAVLNRLLQLE---ELTQtqQQQ 319 Clostridium ...
WP_055246410    243 kIDFQYELSHRFGWGGITLQFAVESGKIKDAIAWSDALNPDFIHTLPKYLKGLKYRKESICTELGLFW---SDDPqeEEM 319 Coprococcus ...
5IBY_A          344 KEDLLGLI 351 Enterococcus faecalis V583
jgi:Theba_1953  322 RDDIINWL 329 Mesotoga prima MesG1.Ag.4.2
jgi:Hore_05080  320 IDDLLTWL 327 Halothermothrix orenii H 168
Q24WR1          320 LQDMKEWI 327 Desulfitobacterium hafniense Y51
jgi:Desdi_1987  321 IEDIKSWL 328 Desulfitobacterium dichloroeliminans LMG P-21439
jgi:Desmer_1647 322 IDDLINWI 329 Desulfosporosinus meridiei DSM 13257
jgi:Acear_0639  325 ENQLAkef 332 Acetohalobium arabaticum DSM 5501
WP_022133536    319 LSDICSlm 326 Negativibacillus massiliensis
CDA61814        320 LEQIASlt 327 Clostridium sp. CAG:169
WP_055246410    320 MKDIIEWI 327 Coprococcus comes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap