4BJJ


Conserved Protein Domain Family
TFIIIC_sub6

?
pfam10419: TFIIIC_sub6 
Click on image for an interactive view with Cn3D
TFIIIC subunit
This is a family of proteins subunits of TFIIIC. TFIIIC in yeast and humans is required for transcription of tRNA and 5 S RNA genes by RNA polymerase III. Yeast members of this family are fused to phosphoglycerate mutase domain.
Statistics
?
PSSM-Id: 337745
View PSSM: pfam10419
Aligned: 106 rows
Threshold Bit Score: 36.4672
Threshold Setting Gi: 326509181
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|...
4BJJ_B        34 FSILGIDQPHPIVRIGGMFFRGTWHQPIGTDIV 66
gi 731453354  40 CKILGIDTERPIMQVDNYVFAGEYEDTLGTCVI 72
gi 41053736   32 CKIVDIDSEQPMLQVGRYLFTGEYEDAIGTCVI 64
gi 992210618  36 CKVVGLDSEQPVLQLGRYVFAGEYEDAVGTCVI 68
gi 72137691   38 CKLLGIGTENPVLQIGNYVFKGEYKKTVGTAVF 70
gi 554845656  32 CKILDIDSDRPMMQVGPYVFAGEYEDALGTCVL 64
gi 573891124  32 CKIVGIDSEQPIIQVGRYVFAGKYEDALGSCVI 64
gi 260836228  42 CKFVGIDSEQPVLQMDRYIFAGEYEDTVGTCVM 74
gi 925201831  24 FKIVGIDTDEPVLQLGNQVFQGEWKDTSGTHVM 56
gi 241848458  32 ccMLGVDTAEPVLKLGSYLFTGEYSDTVGTCVL 64
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap