Conserved Protein Domain Family
TrwB_AAD_bind

?
pfam10412: TrwB_AAD_bind 
Type IV secretion-system coupling protein DNA-binding domain
The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.
Statistics
?
Aligned: 15 rows
Threshold Bit Score: 421.309
Threshold Setting Gi: 123611685
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3SI88        148 LRIHPKLpPI-SKSRETRHILIVGGVGSGKTQTLLPLMRAARERG--------DRAIIFDFKGDFTPDFPSctarhkgra 218 Thiobacillus d...
Q3HKI7        184 RYTIAGI-PF-PPNAVEAQTGIFGTVGVGKTNAIKELLTTIRAQN--------GRAIIYDRMGGLVRDFYD--------- 244 Rhodobacter sp...
Q7MBL9        187 DFKVDGL-ALfKHEFEVQHILIDGTTGAGKSVMLRKLLRWIRKRG--------DKAIVYDKGCTFTSKFFD--------- 248 Vibrio vulnifi...
CAM79179      180 KICFGGL-PL-VKNSERLHILITGTTGTGKTNMLNELLPQIRSQQ--------DRAIIIDLTGAFTDRFFD--------- 240 Orientia tsuts...
Q6MB84        168 PISIGSL-PL-IKGTETQHIMITGGTGSGKTNCLHHLLKSVRQQK--------QRAIIVDTTGLLTERYYR--------- 228 Candidatus Pro...
jgi:Swit_0177 189 GLTLAGV-PL-SREDETMHVAAIGATGSGKSTALHGLMAGALRRG--------DRHIVADPEGAAMSAFFA--------- 249 Sphingomonas w...
jgi:Acry_3560 175 RLSVGGI-PL-EWDREVQHTFLNGAAGTGKTQVAEGFLRAIRERAllpyikksPRVIILDPGGAYYSRFGQ--------- 243 Acidiphilium c...
Q3SHV9        122 RLEIGGV-PI-PIYVEDGGFLLTGSPGTGKSQATTKMLDTLQAGG--------HRAVIADAEGIFYSRYAG--------- 182 Thiobacillus d...
Q1GQ75        169 ALAIATV-PM-PPRLETRHMAMVGTTGSGKTTVLRQILDGVEARG--------EAALVYDTSGEFVAQYYD--------- 229 Sphingopyxis a...
jgi:Ajs_4194  170 PYEIAGV-PM-RVKSETLHTLFAGAQGTGKSQQFFALMKQVRARG--------KRMIVYDPTGEFTQAFYR--------- 230 Acidovorax sp....
Q3SI88        219 iEVE-DVIFAPWDSRSTLWAVARDVDTLSAAREFAARMIVEPgGGSGSPMWANAARQVLVACLVELQSTKPGDWgFADLV 297 Thiobacillus d...
Q3HKI7        245 -PAT-DIIINPFDARSHIWSPFGEASTPEALAQIAEVMIPQR-PGQNDPFWSQTARLVFEYSARSLLRAKRPTN-ADLRR 320 Rhodobacter sp...
Q7MBL9        249 -PSQ-DILLNPFDERCANWDVWCDAKEAPDFENIANALIPQ--HGEGDPFWVDSARTIFSSTAYRMSQDNKPCStARLLS 324 Vibrio vulnifi...
CAM79179      241 -SKC-DKLLNPLEKNSEQWLPWNDCFEAADFHDIASSFSNY--THRIDDFFAKNAELVLSEALKLYQDD--KDI-IKLIH 313 Orientia tsuts...
Q6MB84        229 -AGK-DILLNPLDSRGAPWHPWIECIDKTSYATMAESFIPQS-LSDSDNYWRTSARIVLGSLFEQLKDIQKNST---LAD 302 Candidatus Pro...
jgi:Swit_0177 250 -DG--DILLDPFDARCARWDLLAEIESPSDYAFLASSLLPHL-GTGDHDQWISYAQRLLADTMENFVTLELGST-SDYVA 324 Sphingomonas w...
jgi:Acry_3560 244 -DG--DVLLNPFDARSVAWSPFAEIKRPQDFNRVAAAFVPL--AEGPNKEWSEFGRKTMADTMRAMVRNDEKSP-QELFR 317 Acidiphilium c...
Q3SHV9        183 -DG--AVLFNPLDRRSVSWSPLAELKSPQDCSALAKSLIPD--GHGAEASWNDAAQTVLEGLLRRCWET-SKTN-AELYR 255 Thiobacillus d...
Q1GQ75        230 -PRRgDIILNPFDARCAIWTPFAEIAHPADADRIAQQLITET-GQHDRDVWLETSRILVANMIRALWREGKCTL-PDLLH 306 Sphingopyxis a...
jgi:Ajs_4194  231 -EGK-DILMNPLDSRSPNWNIWNEIAKDYHFDNMANGLIPD--PAESDPFWALAGRMVLKDVIAVLGREGRRTN-RDLYN 305 Acidovorax sp....
Q3SI88        298 AGLTRPVDQLTEAARRYFPEAVKAlgDGQQNvTTAGIQINLMSYLAVIFDLArawPGPG-------IFSIREWLTEVGar 370 Thiobacillus d...
Q3HKI7        321 AIMTISAEELEKLLAGTPGAHFFG--KHVEK-TSASIRANMIAELRFLEFLR---DDGE-------LFSAREWVKSER-- 385 Rhodobacter sp...
Q7MBL9        325 LILTSELETLGNFLQGTESASLVS--KDIKK-TAISIKSVLATYIKSLRFLDgldEKDEhgklkrqPFSITDWVLDDKq- 400 Vibrio vulnifi...
CAM79179      314 TIIYSDNRQFVKAFRNTAVSGIIS--ESAPE-TSAGIQSTLGKNITSLQYLK---PGGN--------FSIKEWFSNSAe- 378 Orientia tsuts...
Q6MB84        303 KILRDPLQELCDFVQGTKAASLID--MNSEK-TAASIRAVMSNFLTCFELLA---NTDQ-------PFSIREWIQQEDp- 368 Candidatus Pro...
jgi:Swit_0177 325 LLGSARIAELKELCAGTSSARYFE--EGGER-MLASILGTLAPAVAHLRLIAm--ASGE-------VFSLRRWIREG--- 389 Sphingomonas w...
jgi:Acry_3560 318 -LLDGSAENLAFYLNNAEIYGLTG--EENMK-MFSNAKATIAPNIEIFQYLK---PDGN--------FSVRDWLRKGDea 382 Acidiphilium c...
Q3SHV9        256 LACVADIEELQQLLAGTAAMTVVG----NAR-YFGEVRPGLGRYLRCFEHLDpaaGRAS--------FSVRDFITEE--- 319 Thiobacillus d...
Q1GQ75        307 ALQVRSKDDLKLWLGNSSSARTFA--DDADR-ATGSVLFMLAKAANLIQFLRideGKET-------AFSFRDFLSGLDm- 375 Sphingopyxis a...
jgi:Ajs_4194  306 AIAKSNLDAMHALLQGTAGATYVD--PTTER-TGMSLKMTVQNQLEAFRFLP---DEGE-------SFSIRKWVHEEG-- 370 Acidovorax sp....
Q3SI88        371 -rVK---TVILQHDGRFETLARAFNSAVLGLAGQLIKSnlVRD------SKERK-LWLFLDEFPELGKVETVLSLAAVGR 439 Thiobacillus d...
Q3HKI7        386 --PG---FVFLTGDAEHSAATRNIISTIIEVSANALMT--CEE------SRDPK-VWFFLDEVPSLNRLPFLQSKLAEIR 451 Rhodobacter sp...
Q7MBL9        401 --RG---FLFLSSNAQQHASLRPLISTWLAIASNAILG--LDP------DDDRR-IWVIMDEMPSLHKLPELDSIIAEVR 466 Vibrio vulnifi...
CAM79179      379 --TG---WLFITATPSQRATLQPLISAWISIAIKALMC--RNP------NHDNKnIWFILDELPALQKVSSLPVALAESR 445 Orientia tsuts...
Q6MB84        369 -iDN---WLFISCKTNERAALNPLLSCWLSVAVRSLLA--LPP------NFERR-LWYIIDELPTLNRLRDLDMLLAESR 435 Candidatus Pro...
jgi:Swit_0177 390 --RG---SLWMPYAANQVAAMRGLVSCWMNIAILETLS--LPA------SRDRR-IWFHIDELDALGRIEGLKDAQARLR 455 Sphingomonas w...
jgi:Acry_3560 383 ndSG---WLFITYRDDQMKLLRQFVAAMADLAILEGLS--LPSneglpaEEHRR-LFYFMDELDSIGAVSELKDALIKLR 456 Acidiphilium c...
Q3SHV9        320 --TG---WLFISYTQEQRAALLPLIQCTLDVASRAILS--LPHttg-drSKLRR-TWLVLDELPLLGRIMSLIPLLTNGS 390 Thiobacillus d...
Q1GQ75        376 -hPGpkpWIFVPRKEDYFEASKPLLACWLECAASALLG--HSP------SAERR-LWFILDELADLPRVDNLARLLPEGR 445 Sphingopyxis a...
jgi:Ajs_4194  371 --DS---WMFITAREAMREALKPVLSLWIDTAIKAVLD--LEP------IHRER-LWFCIDELPTLQKLDILKLALTNTR 436 Acidovorax sp....
Q3SI88        440 SKGIRVVLGLQDISQVKKIYSEHDTNSIVSMVGTQVIAQ-VS--PGETAKYIAENLiGDRDLERLGVSIT--SGAGRAPG 514 Thiobacillus d...
Q3HKI7        452 QFGGAFVLGYQVFAQLEDIYGEKGAQAIAGNLNNRIVFN-TP--DARTAKLFSESL-GFEDVVEQRENLS--FGAHESRD 525 Rhodobacter sp...
Q7MBL9        467 KFGGCYVIGLQSYAQLVKTYGKNTADVIFDLLNSRFYFR-AP--SAQMAQISSKDL-GEQEVDVSRENIS--YGANTLRD 540 Vibrio vulnifi...
CAM79179      446 KYGGCFVAGLQNIHQLEAIYGSAECASMLDLFNSKFIFR-VS--DQVTAYKSALTL-GEEEIIETQENLS--YGSNTMRD 519 Orientia tsuts...
Q6MB84        436 KYGGCAVLALQSPAQLEAIYGQAVAQTLIGNCATKIVFA-EQ--NPLHAGRLADMF-GEQEIREYQKGLS--YGANDIRD 509 Candidatus Pro...
jgi:Swit_0177 456 KVGGCVAIGFQSFAQVKHVYGE-AAHTIVENCGNLLILRcGGggDESTANLANELI-GEREAERDDLSRSqsRGRNASQS 533 Sphingomonas w...
jgi:Acry_3560 457 KFGGCCVLGLQTISQLRAVYGRDTTRAILGNVATNVVLR-PQ--DGETAEEMEKLL-GDQDIERETVTYS--QSAGNSRS 530 Acidiphilium c...
Q3SHV9        391 KHGAAVIATAQTIALFREAYGHDATQTILATLGTWLTLR-VS--DAETAEYMSKSL-GDEEVRRVVAS----GGKNDSGK 462 Thiobacillus d...
Q1GQ75        446 KFGAAVILTFQAIGQMRHRYGQDLSESMLGCCNTKLFLQ-MT--DSESRQWASDTI-GSCEVELPTMTDA--LADGDYKP 519 Sphingopyxis a...
jgi:Ajs_4194  437 KYGLCMVLGVQDFSQLYEIYGHDLAKTIISGCQTKLLLR-VT--DGAAAKLLAELM-GQAEVDEKDETLS--YGLSSQRD 510 Acidovorax sp....
Q3SI88        515 IF--------TSGGNRTSKWedkrelVVLPSELLQLgpdLDLGGVKVWMSGIgeDVLEVLIP 568 Thiobacillus denitrificans ATCC ...
Q3HKI7        526 GV--------AFMSQRTERP------IVTASEIQAL---PQFEALIRFAYDA--PTARVRFE 568 Rhodobacter sphaeroides 2.4.1
Q7MBL9        541 GV--------SIGHQTITRP------VVSSSEIQAM---DDLQCYLRVPGSS--FITQLDLH 583 Vibrio vulnificus YJ016
CAM79179      520 GV--------NMNNVERKKL------LVMPSEIMNL---PDLTCYVKLVGNF--PITKLTMK 562 Orientia tsutsugamushi str. Boryong
Q6MB84        510 GV--------SLNQQTRYQQ------LITKTDIQFL---SRNQAFVRLPDNC--PIVRLNVP 552 Candidatus Protochlamydia amoebo...
jgi:Swit_0177 534 -T--------SVQSRRSVDP------AVLASEIMQL---PNREGFVKRALDP--RWQRVRFP 575 Sphingomonas wittichii RW1
jgi:Acry_3560 531 GMfgnghsntSTGRTANQQRqivtrkCVLASELQNM---ENLHGILMRPAS---PHHPFTLD 586 Acidiphilium cryptum JF-5
Q3SHV9        463 SD--------NWSEQHSTRR------VVMPSQLQNL---PRLHGYLNISGPL--PVCAVTLP 505 Thiobacillus denitrificans ATCC ...
Q1GQ75        520 RT--------TLGRQRKVRP------AVLESEL-RL---PRHRGYLLFPDGL--PVARIALT 561 Sphingopyxis alaskensis
jgi:Ajs_4194  511 GV--------SVMARRQMRD------LVLTSEILTL---PDMTGYLLVPGDY--PIARVKYG 553 Acidovorax sp. JS42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap