1AQ5


Conserved Protein Domain Family
Matrilin_ccoil

?
pfam10393: Matrilin_ccoil 
Click on image for an interactive view with Cn3D
Trimeric coiled-coil oligomerization domain of matrilin
This short domain is a coiled coil structure and has a single cysteine residue at the start which is likely to form a di-sulfide bridge with a corresponding cysteine in an upstream EGF (pfam00008) domain thereby spanning a VWA (pfam00092) domain. All three domains can be associated together as in the cartilage matrix protein matrilin, where this domain is likely to be responsible for oligomerization.
Statistics
?
PSSM-Id: 313592
View PSSM: pfam10393
Aligned: 23 rows
Threshold Bit Score: 59.2484
Threshold Setting Gi: 159162084
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AQ5_C         4 MEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKI 46  chicken
O42401       407 TDEEACKCEAIAALQDSVTSRLEALSTKLDEVSQKLQAYQDRQ 449 chicken
Q5NJJ7       256 LTENACMCEAQIAFQRKVHNSIQTLSSRLDDISNRVQQFDLRR 298 zebrafish
XP_015212118 350 VTADPCKCEAQLAFQSAVQSSIQALTTRLDEVTKKVQQFEYKL 392 spotted gar
XP_005464974 717 sDENMCQCENVIMFQNQVTEKLKSLVQnIAAMSKRLETLENQL 759 Nile tilapia
XP_003411861 440 STEDACGCEATLAFQDKVSSYLQRLNTKLDDILKKLQVNEYGQ 482 African savanna elephant
XP_012396035 435 STQDACSCDATLAFQEKVTSYLQRLSAKLDDILEKLQVNDLRQ 477 Tasmanian devil
XP_012779431 249 VVEDPCKCEARLAFQKQTQAAIQQLAAKLADVTGRIERLENTV 291 zebra mbuna
XP_017157820 264 VVEDPCKCEAMLVFQRQTQATIQQLTAKLADISGRIEHLENML 306 guppy
XP_014330259 785 eVKDPCACENLVEFQQATMNRLDQFTQKLASMAARLEQLENQL 827 southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap