Conserved Protein Domain Family
Fmp27_WPPW

?
pfam10359: Fmp27_WPPW 
RNA pol II promoter Fmp27 protein domain
Fmp27_WPPW is a conserved domain of a family of proteins involved in RNA polymerase II transcription initiation. It contains characteristic HQR and WPPW sequence motifs. and is towards the C-terminal in members which contain Fmp27_SW pfam10305.
Statistics
?
PSSM-Id: 371004
View PSSM: pfam10359
Aligned: 97 rows
Threshold Bit Score: 351.936
Threshold Setting Gi: 511008644
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT01229 1746 GIKVRFDSFMLDMHQRREEFNTRDKGRKMKSRTTGMKIHACQLDLASADIRAVSASIRGTTAESI-QNSLshyihneeen 1824 Sporothrix schenc...
CCH61833 1714 GVKAKVSQFVMDLHQRKELIPSFNKELGIKKNILKMKFFEGDISLQTIDVRALFGHFKEPDFRKVqPKGH---------- 1783 Tetrapisispora bl...
CCH63022 1821 GVKAKVARFVMDLHQRKEAVTTYNKELDQRKTYLQLKFLEGDFSMFGIDVRCLMAKFNKVKYMEEiGEGK---------- 1890 Tetrapisispora bl...
Q6FSI2   1718 GIKAKAGRFLMDLHQRKEVFTEYQEELDRIKKVQKLKFLDGLVATFDIDIRAVHGLFTKLEYTEQrEDAK---------- 1787 [Candida] glabrata
CCC71333 1711 GLKAKVGQFVMDLHQRKEVVTEYKKKLNVTKRVKKLKFLSADILTHRIDIRTVHGIFHKLNFIEEkAHAK---------- 1780 Naumovozyma caste...
CCK70267 1678 GTKTKTKRFTMDLHQRKELVTEYNPELDIRKRVKKMKFLEGEVEMDDIDIRTIHGKFGKLAYVEQkEDAH---------- 1747 Kazachstania naga...
CCF55748 1675 GVKGRAAHFILDLHQRKEVLTAYNKEMNVRKKVQKLKFLEGDVILHGIDIRVIRGELERLKYVEQkEDAR---------- 1744 Kazachstania afri...
CCE93911 1665 GLKAKTEHFVMDLHQRKEVMLKYQEGLDKTKKIMNLKFLEGDVSTAAIDIRAVEATFKSAKFVEEkEDSN---------- 1734 Torulaspora delbr...
CDF87210 1682 GVKAKATKFVMDLHQRKEVLITYQEELNRTKQIMKLNFLAGEVWTKKFDIRTVEGSFKPMTSQHDkKDAF---------- 1751 Zygosaccharomyces...
CAR27565 1700 GVKAKATKFVMDLHQRKEVLITFQEELNRTKQIMKLNFVGGEVLAEKLDIRTVQGKFKPMKTPEDkNSGV---------- 1769 Zygosaccharomyces...
ERT01229 1825 adisrFTIPDDDFSWIDMDDFVELDWILPTEPNPDTKIFPLAFAPRITYFRQTDIGGVISGDPD---RTSPFGHESTHFC 1901 Sporothrix schenc...
CCH61833 1784 -----FDIFDNDMSWYDRSDFKEAFFIEFDKYIPNISMRPLAFSPHFLYQKRASYGDIYQLHPKtlePIVPFNTHISYGC 1858 Tetrapisispora bl...
CCH63022 1891 -----FDIFDNDMSWYDPTDFNEAYFINVENYVPHVYISPLLYSPQFLYQKRASYGDDFQRNPKtfeKIKPFRNDISHDC 1965 Tetrapisispora bl...
Q6FSI2   1788 -----YDIHDNDMQWIDLTDFQEAFYVEIDNFLPNIKILPMLSAHKFIYSKHASYGDKYQVDPKtynPIKPFDNSISHDC 1862 [Candida] glabrata
CCC71333 1781 -----YDIFDNDMSWLDISDFQEAFYIDVSNYVPNVDIRPLLFAPEFVYKKRANYGDKYQLNPKtyeRIEPFNNGVSHDC 1855 Naumovozyma caste...
CCK70267 1748 -----YDIFDNDLTWLDLTDFQEPFFVDVDKYLPSVEIKPFFHAPNFIYQKRSSYGDKFQLDPVtyqPTTPFLNNVSHNC 1822 Kazachstania naga...
CCF55748 1745 -----YKIFDNDMAWLDLTDFKEAFFIDPELYLPNIEIKPFAYAPRFIYQKRASYGDKFQVNPNtyePIKPFRNDISHAC 1819 Kazachstania afri...
CCE93911 1735 -----IQIPDNDLAWYDPTDFEDTDFIDIDSYVPNLRMLRLLYSCQFKYRRRASYGDKFQVDPNthkRIVPFKNNISHKC 1809 Torulaspora delbr...
CDF87210 1752 -----FEVYDNDMAWYDVSDFNEAYSVDLENCVPKVRIQPLLYTPHFVYRKHASYGDKYQVDPKdhqPIPPFENGISHDC 1826 Zygosaccharomyces...
CAR27565 1770 -----FEVFDNDMAWYDVTDFKEAYALGLENYIPHVRIKPFLYTPHFVYRKRASYGDRYQVDPKdhhSIPPFRNDVSHDC 1844 Zygosaccharomyces...
ERT01229 1902 IMTPDDdprTVQMHLVRARLRQLEDQIE----NHVRDINEAVKRINNennasiaNEIETLSRQANVLQEKKSFLENSLRL 1977 Sporothrix schenc...
CCH61833 1859 ILGNHR---HTAKNVVDKRYEYLLKSKE----NLKKSLKAGSTSYTH-----------NKNKLMHDTNAAVKNIKKLKDD 1920 Tetrapisispora bl...
CCH63022 1966 TLGSQL---SSGKCLIRSRLATLQASEE----EVREAIKKNKSSASK--------------KLLKDTIEAVKNVNLLCDD 2024 Tetrapisispora bl...
Q6FSI2   1863 AIRKPF---TPNFEVIRDRLERLKHVKA----TIESNHYGMDSESEQ----------KAHEKYLVRSEASVRNVQSLLED 1925 [Candida] glabrata
CCC71333 1856 IMGEHI---EIPPSLIEKRLEVLEEFEL----KIKAKLRKSIDPTEK----------AKLTTFLNMTAQAKESVELLLAD 1918 Naumovozyma caste...
CCK70267 1823 VLGREV---QVPTKVLEDRLKNLTSFQT----QLTNDYLKTEDPSKK----------KLLNYLLEKAKVGLDSLDLLHDD 1885 Kazachstania naga...
CCF55748 1820 VLGQRV---DIPSETLDNRISQLSEFRStwetRLDEELMKPSNEQNK-------LKIKDYETLVHKAKVSLESVDLLLDD 1889 Kazachstania afri...
CCE93911 1810 VFGEPL---KLPFKALRERKERLIEYKD----KLEQKLSGNDDESDV----------TFIKRHIKKTNTAIEKVELLLKD 1872 Torulaspora delbr...
CDF87210 1827 SLGKAK---LLQLGILEERVQLLKDLKA-------KSINGEDSNLHH----------GNQQELLAKLSLGIEKAQHLLED 1886 Zygosaccharomyces...
CAR27565 1845 TLGHAE---HLQLGILKQRVHTLKDLRT-------KKAQENGDASHK--------------DFMQKLDLEIEKAQNLFED 1900 Zygosaccharomyces...
ERT01229 1978 LAEETAaastaraaaaasakaateareakrrereksgsvgpspsnengpsDASAAAN--AAASadgdkvgADSGAEFASE 2055 Sporothrix schenc...
CCH61833 1921 LLTLQkqr---------------------------------------tnpDEELEYNfkSIGS-------IHSVTSSISK 1954 Tetrapisispora bl...
CCH63022 2025 MDTLSkqi---------------------------------------aspESEYKYNypIIKS-------LYKPKNVKDG 2058 Tetrapisispora bl...
Q6FSI2   1926 LEIMTglk---------------------------------------ekiDSSKAYNypAIQL---------IQDTNSES 1957 [Candida] glabrata
CCC71333 1919 FNSVCPktg--------------------------------------kilTESGCFRypSLQL-------LHNSKLRNKS 1953 Naumovozyma caste...
CCK70267 1886 VSALCYers--------------------------------------estNDRRVYSipGVQI-------LDRSTVSTKE 1920 Kazachstania naga...
CCF55748 1890 LSALCYerd--------------------------------------vstSAQRTYTmpTVQL-------LDRSSVTKKS 1924 Kazachstania afri...
CCE93911 1873 FETLKrkq---------------------------------------dceNFEPSFNypMINM-------VQNSVIAANE 1906 Torulaspora delbr...
CDF87210 1887 FRYMHdhe---------------------------------------ngpAGSHNFYyeLPNL---------MRESMAQV 1918 Zygosaccharomyces...
CAR27565 1901 FEHMQnhk---------------------------------------gdsADSHEYHyeLPNL---------MKRFLSES 1932 Zygosaccharomyces...
ERT01229 2056 FTNRFVVHNIKLKWNNMLRNIILRYIHQVSQRRGFVYYLSRPAVKFIIDIVEEQVKLKAGATPNTgdsssvatgatgtsp 2135 Sporothrix schenc...
CCH61833 1955 FQNRYFIFNILLKWNEEVRDIVYKYLLFFTLRRNFYSLGSYKSLKIFDDMIKQFTQT--SEISKKysa----------sd 2022 Tetrapisispora bl...
CCH63022 2059 FQNRFLLMNMLLKCNIMNRDILYKYLNYFSLRKDFYAFEMQKSLRIFDEMLEKIEGSFKDSS------------------ 2120 Tetrapisispora bl...
Q6FSI2   1958 FDNKYYVYHMLLKWNEGVRDIAFKFLHFSNLTHQFMELASHKTNRMFNDIINKRQQKDNVNEEEDiss----------ki 2027 [Candida] glabrata
CCC71333 1954 FENRFLVFNMLLKWNEKVRDVVLRYLHFFNLTSDFHKLTSQHALETFDNILKQRLSQNQKSELEShge----------pi 2023 Naumovozyma caste...
CCK70267 1921 FENRFFIFNMLLKWNEDIRDIIMKFLHYLSLASKFSSLSSQKSLKIFEEMMKHRIMNEKKMDMETineeqe-----pidl 1995 Kazachstania naga...
CCF55748 1925 FENRYFIINMLLKWNESVRDVIFRYMYLLTLSNEFASLASQKTLHVFEDMLQHKTSSEWKPGMQPakekpi-----ekkt 1999 Kazachstania afri...
CCE93911 1907 YENRYHVCEMLLKWNEGTRNAVFKYLHYLSLSRQLSSLSEQQCSKLIDEIIRRKNAPGDTDRNSIdsq-----------n 1975 Torulaspora delbr...
CDF87210 1919 YENRYCINYMLLKWNEDTRDAMYKFLYFLGLADQFSALSASKSLQIIEDVVRQKTDYDQMRSRQEddr----------vp 1988 Zygosaccharomyces...
CAR27565 1933 YEHRYCVNYALLRWNEDTRDALFKFLHYISLAHQFSQLSATKSLQIIEDVVKQKTESVLTEENHHhgs----------np 2002 Zygosaccharomyces...
ERT01229 2136 gAQQSADGAYNGDQ-----------TSGKDIEDRIRK----ILQDGrkfvsteefandcggknegtvyctpmeelsggia 2200 Sporothrix schenc...
CCH61833 2023 kEKSSSDILYERTSppe---------mnEALKKIFEEgiydFFDTD---------------------------------- 2059 Tetrapisispora bl...
CCH63022 2121 ----GPKFEQKKSKcdwayesssgnTTSTALLEIFKNgmteILCGC---------------------------------- 2162 Tetrapisispora bl...
Q6FSI2   2028 qRVKSEVEFDNANDdeh---------vkAALLEMFEEglsqLGIDI---------------------------------- 2064 [Candida] glabrata
CCC71333 2024 eRLNSKEQFRNAEDqsa---------inNALVELFETalssLQCSI---------------------------------- 2060 Naumovozyma caste...
CCK70267 1996 qMGSGNKFGNKTDDlmh---------lsEICLDLFENgittVEADI---------------------------------- 2032 Kazachstania naga...
CCF55748 2000 fKNNFNDYPNKTPDi-------------KTIFEMFENelleLPVTL---------------------------------- 2032 Kazachstania afri...
CCE93911 1976 rDGSQFEAELNRSNeen---------fnEVLEKIFKEgiseLGVDI---------------------------------- 2012 Torulaspora delbr...
CDF87210 1989 hEKRTVEIDLSNLKdne---------lnQSLSKILEKhlteLNISV---------------------------------- 2025 Zygosaccharomyces...
CAR27565 2003 tKKPTKDIDWDALDgsn---------inYMLSSILEKhmseLEVPV---------------------------------- 2039 Zygosaccharomyces...
ERT01229 2201 tEFTPQNNYHVHLIAPQIQLQSDKNKKHVVLVTAKGMELKVVEVMDKARLSDNVSGLVQRRFLVGMDSTQFFVTHRKWFS 2280 Sporothrix schenc...
CCH61833 2060 -SFAIHENSVIQFIAPQIQLMTKTLNNACVLISAPVTEIKKVGFEEGQRNYLSKEGVVLNRSAIYLEKVNVFLFHQDTNE 2138 Tetrapisispora bl...
CCH63022 2163 -SHAFYSDMIVELIAPQVQFMTDIKQDNCVIVAAPVIKLKAVSFDSRSERDVTNENVILTRYGLYMEGGNVFVFHKDEYR 2241 Tetrapisispora bl...
Q6FSI2   2065 -NHSISRNHFVNFICPQIQLISDDDPNICVLVSTPIILLKVLSFDEETPDNVYLENTFLKRYGLFLSNANAFIFHKERFD 2143 [Candida] glabrata
CCC71333 2061 -KSVRHENHYVQFITPQVQLMTKEENDSCVIISAPNVMMKVLAFEDERTEEINIDNDFLKRYGIIVTNANAFLFHKGDFK 2139 Naumovozyma caste...
CCK70267 2033 -EYLVHKNTFLQLVAPQVQLSMREEPDMCVIVTAPNIITKNLSF--EQVGMEDHDDQFLKRFGVIVNNANAFLLRKADFK 2109 Kazachstania naga...
CCF55748 2033 -DHIIHKNNFIQFIIPQIQLTTEDDPDSCVIVTAPNVISQMISFEPKLFENIYYQDRFMKRNGLIANNANAFIFNKQNFK 2111 Kazachstania afri...
CCE93911 2013 -DYEVHHNHIVHFISPQIQLITEQEPDSCVVVAAPSIMMKVMSF--GNKEAQYSDEAFLKRYAVHFIKGNVFHFRKDEYH 2089 Torulaspora delbr...
CDF87210 2026 -KNVSRSNHYVEFLSPQIQLITNEEPDACIMVTSPGVKLEVVSFEGDTTNDEYRRDTIMKRYGVHVVNANVFYFRREDYM 2104 Zygosaccharomyces...
CAR27565 2040 -KHILRNNHFVEFLSPQIQMVSHEEPDSCVMLTSSGMKMEVVSFDGDLNGDEYRRNTMLKRYGIHVVNSNVFHFHRKDFM 2118 Zygosaccharomyces...
ERT01229 2281 -T---RILSAYSGSSYGAPSGSSWPPWVPMEA 2308 Sporothrix schenckii ATCC 58251
CCH61833 2139 -D---YFELFFDPNPYGHHGVKNWPPWLGVEL 2166 Tetrapisispora blattae CBS 6284
CCH63022 2242 -N---FFRLFFDDNPYGHSKNQKWPPWLGLEI 2269 Tetrapisispora blattae CBS 6284
Q6FSI2   2144 -K---YPELVFDASLYGQEKGSDWPPWLGAEV 2171 [Candida] glabrata
CCC71333 2140 -D---NFELFFDVSSYGQSKNSKWPPWLGLEL 2167 Naumovozyma castellii CBS 4309
CCK70267 2110 -N---KYELYFDMNSYGQKKGTEWPPWLGIEq 2137 Kazachstania naganishii CBS 8797
CCF55748 2112 -N---KYELFFDMSSYGQVKGAEWPPWLGVEI 2139 Kazachstania africana CBS 2517
CCE93911 2090 vDregFHEVFFSLSGYGQEDETQWPPWLSLDL 2121 Torulaspora delbrueckii
CDF87210 2105 -D---YLDLYFNVAAYGHVEGTSWPPWVALEL 2132 Zygosaccharomyces bailii CLIB 213
CAR27565 2119 -D---HPAMYFDIAAYGHVEGTSWPPWVALEL 2146 Zygosaccharomyces rouxii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap