Conserved Protein Domain Family
DUF5427

?
pfam10310: DUF5427 
Family of unknown function (DUF5427)
This is a domain of unknown function. Family members found in Saccharomyces cerevisiae, are synthetic lethal with genes involved in maintenance of telomere capping. However, experimental evidence is yet to verify the exact function of family members and the domain.
Statistics
?
PSSM-Id: 370966
View PSSM: pfam10310
Aligned: 75 rows
Threshold Bit Score: 187.915
Threshold Setting Gi: 505754394
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EMR63310  18 FEGIG-DDSAVKK--------------PTKAKSTAPKSRGgdKHEkDPLAELEnEL-EevpsrphtprvrDA-------V 74  Eutypa lata UCREL1
CCK72339  36 LGSLPqGK-----------------------AEQGREQEKgeGDG-DVFEFLE-ELeK------------SNlsv-ggkR 77  Kazachstania nagani...
EDO18125  16 LDSLPeAK---------------------KNDQNDQSKDNgkKDE-DILDFLD-ELeK------------SNle------ 54  Vanderwaltozyma pol...
CCH61053  16 LDSLPqSGqngdk---------sdsmkDSKDLGSSKAGSNtkKDE-DILDFLD-ELeK------------SNlsl-nkeK 71  Tetrapisispora blat...
CCC67528  17 LESLPeTSsn---------------gnQDDKTKDATKKDPqkKDE-DIMDFLD-ELeK------------STadl-sekK 66  Naumovozyma castell...
CCK73593  17 LESLPsENatd-------------ksiDDTNDNKGKTNEGgaGDE-DIMDFLD-ELeK------------SNlsi-ekpS 68  Naumovozyma dairene...
CAR27651  14 LESLPeAKggad------------skgDKKEKTEEKKSGGkqGNE-DIMDFLD-ELeK------------SNlsvpkkeE 67  Zygosaccharomyces r...
P47018    16 LDSLPeAKNGGKMvntdvkgsqegvkgGSNSVAGKTGNDGkkGDD-DIFEFLE-ELeK------------SNlsl-tdkK 80  Saccharomyces cerev...
Q6FL79    17 LDSLPeDK--------------------KGAEGKSKAKGAgkKDEeDVFEFLE-ELeK------------SKmdl-gakK 62  [Candida] glabrata
CCF59209  17 LESLPnDG--------------------ANEKVDDGNKKKgnKDE-DIFEFLD-ELeK------------SNlk----sK 58  Kazachstania africa...
EMR63310  75 SsKRT--------------STATPPPGap----rQSEDKS-Tnl------------pRKSVESTR--SFHA-SFTPSATS 120 Eutypa lata UCREL1
CCK72339  78 GgEAGgekqvtekgtgkqrLLRRWKGKtqrslnkNK------------------------------------GAEAAGEq 121 Kazachstania nagani...
EDO18125  55 lnKNKtnsgdsannnknkkKASNNTKQeskpqsvGKEETKkApiknneqkpvkeeikEVPLDEVT--NKEEsINENQEQD 132 Vanderwaltozyma pol...
CCH61053  72 SeGSKvsktktenddkivkNDSSPAVIenssstsSTQMGKk----------------DQNEDSLKkeELKQsDEEKEEEe 135 Tetrapisispora blat...
CCC67528  67 DkKQTkkveervktedqpvQKEEKEKEeskekitAE-------------------------------TAKTpEQEQEEEQ 115 Naumovozyma castell...
CCK73593  69 KkKKGltgnsadktgqqsaKEEGKEKTekvsptiTKEKEEeVisgk-----------------eeeeNQEQgHEEEEEEE 131 Naumovozyma dairene...
CAR27651  68 AqEKKkeeiskmkpskeepSKEEPPKEeppkeeaPKQELPkQeplk-----------------eeapKQEPpKKEQPKEV 130 Zygosaccharomyces r...
P47018    81 GvEKKapsesvnnkaqdekVEESKENKnseqdahGKEKEPq--------------------------QQEKeEEEEEEEE 134 Saccharomyces cerev...
Q6FL79    63 GkKVAetkkldpqesndgkAKSETKQEa--------------------------------------pAVKKdTEEKSEEA 104 [Candida] glabrata
CCF59209  59 GkEAKvarkqeqplekegaKQEPEETKpkevepvSNE------------------------------TVSKgTVENPEEn 108 Kazachstania africa...
EMR63310 121 S-ELQDAEKKg---------PVEQAAPAASGGAG--GGWWGGifatasaTANAAMKQAEAaykeiQKNEEAK----KWAE 184 Eutypa lata UCREL1
CCK72339 122 eg----------------eqSPAAPDSASPAGAFslSNWWSA-------SGSATVSQLWN-----RTTEQAT----TLTN 169 Kazachstania nagani...
EDO18125 133 Svpk--------------egTPLN----DPITSF--SNWWSS-------SGSAAVTNIWN-----KTQKQAS----ELQK 176 Vanderwaltozyma pol...
CCH61053 136 ee----------------adEPLG----DPISTF--SNWWSS-------SGSATVSSFWN-----KTTEQAS----QLKN 177 Tetrapisispora blat...
CCC67528 116 Vn--------------------------DPITSF--SNWWSS-------SGSNTVSSLWN-----KTTEQASthlkKVTE 155 Naumovozyma castell...
CCK73593 132 Veqg-------------rdgTPLN----DPITSI--SNWWSS-------SGQATVSTLWD-----KTTKQATsqikKIGD 180 Naumovozyma dairene...
CAR27651 131 PpKESKGFHRegtpvesredTPLN----DPITSF--SNWWSS-------SGSATVSNFWS-----KTTEQAS----QIKT 188 Zygosaccharomyces r...
P47018   135 Eeee-------------eeeTPLH----DPIASI--SNWWSS-------SGSAKVSSIWN-----KTAEQAS----QIKN 179 Saccharomyces cerev...
Q6FL79   105 SnAKVean----------eeTSKQGTNPDPIASI--SSWWSS-------AGSATVSSLWS-----KTTEHAS----QIKN 156 [Candida] glabrata
CCF59209 109 eq----------------dgEPLN----DPITSI--SNWWTS-------SGSTAVSNLWS-----KTTEQAS----KVKD 150 Kazachstania africa...
EMR63310 185 QVRG-----NVGALKGL-GDDLRHR------------------ALPTIADIMHTLAPPI--SSHERLLIHITHDIVGYPS 238 Eutypa lata UCREL1
CCK72339 170 KIAQehlhdLQG---SL-PIKLDGS---------------------TISELARNLQKIVvgETEEVLRIHLVHDFVNVKY 224 Kazachstania nagani...
EDO18125 177 KIVDeqsqiPIKELTSL-TSKLKTS---------------------TITDLANRLQEIVvgETEEVLRIHLVHDLVNYPL 234 Vanderwaltozyma pol...
CCH61053 178 HLSQ-----EQQ---DFiAQSANRVkninmnkvvdmnvvnsvvNKSKITELAKNLQKIVvgETEEVLRIHLVHDLVNYPN 249 Tetrapisispora blat...
CCC67528 156 RINQ-----EQQMEDSI-ASKLTKNl-----------------NPIKISELAKSLSKIVvgDTEEILRIHLVHDLINYSY 212 Naumovozyma castell...
CCK73593 181 KIGQ-----DQL------LQQSRGA--------------------IKITELAKNLSKIVvgETDEILRIHLVHDLINYSY 229 Naumovozyma dairene...
CAR27651 189 RLAQ-----EQL---DL-TSRLNTN---------------------TITDLARNLQKIVvgETEEVLRIHLVHDLVNFSF 238 Zygosaccharomyces r...
P47018   180 RLAQ-----EQL---DL-TSKINTS---------------------TITEIARNLQKIVvgETEEVLRIHLVHDLVNYPS 229 Saccharomyces cerev...
Q6FL79   157 RIQQ-----EQL---DI-TSKLNTQ---------------------TITDLARNIQKIVvgETDEVLRIHLVHDLVKFPS 206 [Candida] glabrata
CCF59209 151 RIQK-----EQQ---TL-TTTLPIKi-----------------NTNTISELAKNLSRIVvgETEEVLRIHLVHDLVNYSN 204 Kazachstania africa...
EMR63310 239 LDPLIYEVFSRVM-SQVEGGDLLVIQRGQESTA---RRASDVtytkhsSSSSVAGWRDGPWWRqv--dAP-RNL--GAVR 309 Eutypa lata UCREL1
CCK72339 225 LQRHVEQKFDQVLsSQVQGGVRIFVDEWGRPGHrdaEDEDSE------EEQERQDESHS------------ASF--NVFY 284 Kazachstania nagani...
EDO18125 235 LQYHVEQKFHDVLsSQVQGGIRIFVDEWTNPNErelYEKEVE------PTSKESKK---------------RQL--NMFN 291 Vanderwaltozyma pol...
CCH61053 250 LQYIIHEKFNQILnEQVQGGIRIFVDEWGKPNSnsnLNLLNL-------ANKNINNQLNNIANnininSLpPNF--NVFH 320 Tetrapisispora blat...
CCC67528 213 LQYQIETKFDQVLsSQVQGGIRIFVDEWGNPNKkmdSSITNEfnda---------------------kflkRKL--NLFN 269 Naumovozyma castell...
CCK73593 230 LQYQIEDKFHQVLsSQVQGGVRIFVDEWGNPNKkdtGRRSTItdfne-------------------akflkQKL--NLFR 288 Naumovozyma dairene...
CAR27651 239 LQTIVDQKFDEVFsSQVQGGIRVFSDQWGHPHRtedEMNFHFts-------------------------qqPKL--NIFT 291 Zygosaccharomyces r...
P47018   230 LQYNIESKFDQVLsSQVEGGIRIFVDEWGHPNNngiTPVEKK------PSVADGELGNSK-----------KKLqfNLFD 292 Saccharomyces cerev...
Q6FL79   207 LQYHIENRFDQVMsSQVEGGIRIFVDEWGRPNRsnsISTVVD------PEKREHEEKDAIEPK--------IKL--NLFS 270 [Candida] glabrata
CCF59209 205 LQYYVESKFDQVLsSQVQGGIRIFVDEWGKPHQddtTTISFInd-------------------------nrRSL--NLFV 257 Kazachstania africa...
EMR63310 310 G-LPEGTKLCRVGAESYAHDYFAGRGGIA-----------------EAQRRALEPVSDENPVRTSDIFLAVQAITVDATP 371 Eutypa lata UCREL1
CCK72339 285 GkVADGEKLAFANLDNAVKLFSKAHDEMLrqq---------------reSTDGGSAPAQTPDSISDVFVSLLAIAPPERT 349 Kazachstania nagani...
EDO18125 292 GkVVEGEKLAFANLDNAIKLFHKSRENIIkqqkeak----laetdqDQESKQSDTEAGDEEDNISDIFISILPVSVPGTN 367 Vanderwaltozyma pol...
CCH61053 321 GkIIDGEKLAFANLDNAIELFNKAQKEIQnqqnea-----kkeaneATATNDNDEDEDEQIANIIDIFISILPIAPSSSS 395 Tetrapisispora blat...
CCC67528 270 GkINDGEKLAFANLDNSIKLFNKAHEEIMkqk------------keNEKQEGKDGKDENDQNKISDIFIAILPIAIPNTG 337 Naumovozyma castell...
CCK73593 289 GkTTDGEKLALANLENSIKLFNKAHDELLkrkkel-----nekddeNSENDDDDEEEEEEQNKISDIFIAILPIAVEEKG 363 Naumovozyma dairene...
CAR27651 292 GkITDGEKLAFANLENSIKLFQKAHEEFMrqkeahstatnerqeqeQDGEDADDDEKDDQEDRISDIFISILPIAIPTKQ 371 Zygosaccharomyces r...
P47018   293 GkVTDGEKLAFANLENAVKLFNTAHEEYQkqq-----------keaDATPDDDRSSISSNSNKISDLFISILPIAIPQKQ 361 Saccharomyces cerev...
Q6FL79   271 GkVSDGEKLAFANIDNSIKLFNKAHDEYIrqq------------keAEGESEEGSSAEKSENRISDIFVSILPVAIPDKN 338 [Candida] glabrata
CCF59209 258 GkITDGEKLAFANLDNAIKLFNKAQEEISkqqk----------eaaDGDDENEKNTNEDTKDNISDIFISILPISIPISG 327 Kazachstania africa...
EMR63310 372 alfagstAE-KAEKESS----GVADDDESsaadAHVCFAVYVLDPVHEIVYSTVSQALPARWIRWLDTPsattttattss 446 Eutypa lata UCREL1
CCK72339 350 ----------DAENEPV----KTTDAAVG----GNFSFTVVLRDVSNDITTVTRSQGFPLQWLSWLEGS----------- 400 Kazachstania nagani...
EDO18125 368 -------KD-----DPI----KTTDGNAP----GNFSFIIVLKDITNDITSITRSQGYPSKWAGWLEGS----------- 416 Vanderwaltozyma pol...
CCH61053 396 --------AkMDDDKST----IITDTTHS----GNFSFTIILKDISNDITSITRSQGFPLKWLKWIENS----------- 448 Tetrapisispora blat...
CCC67528 338 ------------KDDDI----ITTDPSHP----GNFNFTIVLKDITNNITTITRSQGFPLKWVKWLENY----------- 386 Naumovozyma castell...
CCK73593 364 --------KtSSDDKDI----ITTDASYP----GNFNFTIVLKDITNNITTITRSQGFPLKWVKWLETE----------- 416 Naumovozyma dairene...
CAR27651 372 -----------EDENEI----VTTDPHQP----GNFSFTVVLKDITNDVSTITRSQSFPLKWVSWLEGD----------- 421 Zygosaccharomyces r...
P47018   362 --------------KDAdgdfQVTDSNTP----GNFNFTLVLKDITNDITTITRSQGFPVKWVNWLEGS----------- 412 Saccharomyces cerev...
Q6FL79   339 --------------DSTkedmIVTDPHHA----GNFSFTVVLKDISNDITAITRSQAFPTSWVEWLEGE----------- 389 [Candida] glabrata
CCF59209 328 --------SkDVETDDI----LTTDSSQS----GNFNFTIVLRDITNNITTITRSQGFPNKWAEWLEGT----------- 380 Kazachstania africa...
EMR63310 447 gpTPKASG-----------SGDSeeeesseeeeeddddeegnerpppqrqtggarggggaaigvegdglSIPDEIRAIVE 515 Eutypa lata UCREL1
CCK72339 401 --ALPMQ--------------------------------------------------------------TGEDPTPGADA 416 Kazachstania nagani...
EDO18125 417 --YELTSKddaisqakekdEKKKqs------------------------------------------ssNEEDEEDEEDE 452 Vanderwaltozyma pol...
CCH61053 449 --KDEEDNekdssksenatLTQKtten---------------------------------------ketKGNDETDDEDE 487 Tetrapisispora blat...
CCC67528 387 --NDDEGEdadadadtnekTN------------------------------------------------RDKEEEEEEEE 416 Naumovozyma castell...
CCK73593 417 --KDKGEEea----------------------------------------------------------kEEAADEEAKEE 436 Naumovozyma dairene...
CAR27651 422 --SEWKTKgkkeqegkeqeGKQQq---------------------------------------------QQQQQQQEDDE 454 Zygosaccharomyces r...
P47018   413 --VEKTGStaseernksydQK------------------------------------------------KQKESEDEDED 442 Saccharomyces cerev...
Q6FL79   390 --TKKNKE-------------------------------------------------------------SKKGDDNEDEE 406 [Candida] glabrata
CCF59209 381 --KDEDNTkqeekskkeeeE-------------------------------------------------EEEEKEPANDE 409 Kazachstania africa...
EMR63310 516 GGGVDPREWVAEWVEETLTLSIGVLAQRYVARRMGV 551 Eutypa lata UCREL1
CCK72339 417 DDDLDPREWVQGWAEDGLALALGVAAQNYVINRMGF 452 Kazachstania naganishii CBS 8797
EDO18125 453 SNNIDPSEWVKEWIEDGLSLTFGIAAQNYVIERMGF 488 Vanderwaltozyma polyspora DSM 70294
CCH61053 488 DDGVNPAEWVQNWVDDGINLAFGTAAQNYVLERMDf 523 Tetrapisispora blattae CBS 6284
CCC67528 417 ELGVDPGDWVKEWIEDGLNLAFGIVAQNYVIQRMGF 452 Naumovozyma castellii CBS 4309
CCK73593 437 ELGVDPGDWVKDWIEDGLNLSFGIVAQNYVIQRMGF 472 Naumovozyma dairenensis CBS 421
CAR27651 455 DEDVDPSDWVRDWVEDGLNVAFGVVAQNYVIKRMGF 490 Zygosaccharomyces rouxii
P47018   443 DEIIDPSEWVKEWIEDGLSLSFGVMAQNYVIDRMGL 478 Saccharomyces cerevisiae S288C
Q6FL79   407 DDIVDPGEWVKDWIEDGLSLSLGILAQTYVIKRMGL 442 [Candida] glabrata
CCF59209 410 EGEIDPSDWVRDWIEDGLSLVFGVVAQNYVIDRMGL 445 Kazachstania africana CBS 2517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap