Conserved Protein Domain Family
Tmemb_cc2

?
pfam10267: Tmemb_cc2 
Predicted transmembrane and coiled-coil 2 protein
This family of transmembrane coiled-coil containing proteins is conserved from worms to humans. Its function is unknown.
Statistics
?
Aligned: 37 rows
Threshold Bit Score: 248.419
Threshold Setting Gi: 620976193
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015782805         50 KAAIEHYQAKIMRTKEAIKAEQTSRDENVNEYLKLAANA--------DKVQTQRIKSMFEKKNQKSAHTIAQLQKKLDSY 121 two-spot...
CRZ25036             41 lddrTRIERKIEQIKERLSRISLAREADVDDFLSMTSSMeg----grENPQLARVRQHFEKKNKKSSQEIEHLKKKLEQL 116 Brugia m...
Q18025               21 ereKAKIVQKLIEIKDKLRALNEKREADVEKFLSITRQSeisrgvgaDNPQRARIRNNFERQNRKHAHETEMLQKKLIDY 100 Caenorha...
EKC40365            112 KAAIEHYQRKLNKTMELIKAEQAAKEENVNEYLRLAASAs------eDKQQLARIKAVFEKKNQKSTQSISTLQKKLEGY 185 Pacific ...
ESO02390             88 RSAIEQLQVKIGKTQQRIKLEQNAKEDNVNEYLKLSTDA--------DKQQLQRIKAVFEKKNIKSAQAIAHLQKKLEEY 159 Helobdel...
WGS:AAPP:GF16655-PA 254 VQAIDRLNTKIQCTKESIRQEQTARDDNVNEYLKLAASA--------DKQQLQRIKAVFEKKNQKSAHNISQLQKKLDNY 325 Drosophi...
Q16ZT4              120 SLAYNRITTKIACTKESIKKEQTARDANVNEYLKLAASA--------DKQQLQRIKAVFEKKNQKSAHNISQLQKKLESY 191 yellow f...
EDS32659            118 SLAHNRIITKIACTKESIKKEQTTRDANVNEYLKLAASA--------DKQQLQRIKAVFEKKNQKSAHNISQLQKKLESY 189 southern...
XP_007667852            -------------------------------------------------------------------------------- platypus
XP_014347179        239 RAAQRHLQQKILRLVEQIRVEETERDQNLSEYLQMANNV--------EKRQAFRIKQTFEHRNQKSAAAIAQLQHRLEHY 310 coelacanth
XP_015782805        122 LKR---IRDIEny-----gIQALHq-------hSRSKAMLTNVGHGLKGVGtni--kegISGLSE--------------- 169 two-spot...
CRZ25036            117 QSK---LVDLNmgivsevsPKSSVln-----niRKTGPLLR--------------------------------------- 149 Brugia m...
Q18025              101 EER---LKLVDsg----eyEPSPTksrvfptgiRKAKGMTE--------------------------------------- 134 Caenorha...
EKC40365            186 SKR---IEEIQ--------TSGVTs-------hKKAKEVLSDMGHGLKGVGani--vdgITGFSGgvvgni--------- 236 Pacific ...
ESO02390            160 DRK---LREISl-------QGTTAi-------hKGSKGVLKDVGQGLRVLFvrdptrsrDASPSTs-------------- 208 Helobdel...
WGS:AAPP:GF16655-PA 326 TKR---AKDLQnh-----qYQTKSq-------hRQPREVLRDVGQGLRNVGgni--rdgITGFSG--------------- 373 Drosophi...
Q16ZT4              192 SKR---YKDMQyh-----qNQKQQs-------iRQPREMLRDVGQGLRNVGgni--rdgVSGLSA--------------- 239 yellow f...
EDS32659            190 SKR---YKDLQyh----qsQKQQQs-------hRQPREMLRDVGQGLRNVGgni--rdgVSGLSA--------------- 238 southern...
XP_007667852            -------------------------------------------------------------------------------- platypus
XP_014347179        311 HHKvmeLKELElklranpeQESKG---------RSPR--LSNVTR--------------ESSLSMiqsmqsvaprkpatw 365 coelacanth
XP_015782805        170 --------------GVIGSIKSFSspntHhssgdnfnskpkdSF--KNKIGSADNINSADnsindsst------------ 221 two-spot...
CRZ25036            150 --------------EVIAAPRGIA----H-------------II--KSTFGSADNIPDSI-------------------- 176 Brugia m...
Q18025              135 --------------TMVNAPIEFA----Q-------------RV--KSAF-SADNVNSTQ-------------------- 160 Caenorha...
EKC40365            237 ---------kgakdTMMAKPKEFA----H-------------LI--KNKFGSADNINQIK-------------------- 268 Pacific ...
ESO02390            209 --------------TMQLKSRNAAtlpgvwk-----tkdshhAF--KNRYGSADNITSSLi------------------- 248 Helobdel...
WGS:AAPP:GF16655-PA 374 --------------SVMSKPREFA----H-------------LI--KNKFGSADNINQMT-------------------- 400 Drosophi...
Q16ZT4              240 --------------TVMSKPREFA----H-------------LI--KNKFGSADNINQLSstwyadhnimeinrdlntsh 286 yellow f...
EDS32659            239 --------------TVMSKPREFA----H-------------LI--KNKFGSADNINQLAanhnviemnrdlta----sn 281 southern...
XP_007667852          1 ----------------------------------------------mkspspglppddpslvprssrtktpsirhhsana 34  platypus
XP_014347179        366 prngrvsssepvedTMSLRPPDFA------------------MGtlKTTVPAADSRDMAG-------------------- 407 coelacanth
XP_015782805        222 ----mnesesneGKEAQSkssgvHNQGGSVFYTHSHTHSHSTK--------------------------HTSDESSSISS 271 two-spot...
CRZ25036            177 -------------------------ASGASNVGHSTFYSDTQT-----------------------------NDRIHKLD 202 Brugia m...
Q18025              161 -----------------------NGTTGAPKTGQSTFFTTRKSadtdev---------------esnavHKNRGAKRNSS 202 Caenorha...
EKC40365            269 -------------SLEEAggtegDKQHGGTLPASFk---------------------------------YPSEDDNS--- 299 Pacific ...
ESO02390            249 ------------PTQSSVnpsnpNNLQSSSSANNSPIVNLTSQqqrlqlqq----------rlqqqqhqQLQDDSLNDEQ 306 Helobdel...
WGS:AAPP:GF16655-PA 401 ------------DAELQG-----MQSSNADVLAANERLQQTPGvgtstgsggggqnnntgggagsgtgkFNSDNGSECSS 463 Drosophi...
Q16ZT4              287 lddnvsfryenvLNSTLG------GESDTIGISSPGIIGDLEG--------------------------KYSEQGSDCSS 334 yellow f...
EDS32659            282 iddsvsfhydnlSSSNVGihgvcLDPADTRVISNTRIVEDASG--------------------------KYSEHESECSS 335 southern...
XP_007667852         35 evnrilqdsikhrilylseqlkvekssrdenmvgylklvskadrhqaplirqafekvnqrssatigqierklqqnyrqlq 114 platypus
XP_014347179        408 ----------------------------------------------------------------------TSPDEAASSR 417 coelacanth
XP_015782805        272 vsd------------------------niGAIAGLVTSGASSASpakqlyrtfdsqlvsQSGSSHNIHDLETILSQLRDR 327 two-spot...
CRZ25036            203 fenrdvapspakrghkrnetlpsmafdldNLVISSLPEMLPHDE---------------PEVKFTAANTVIELHNDIQEL 267 Brugia m...
Q18025              203 tlppnlsltspdplsaykeedssdpesrpGSAADETSNVPYHTAdnslylp--pnhpyhSAHAAPSEEGFNAIHEHLNSI 280 Caenorha...
EKC40365            300 -----------------------------SILSGSNFEIQSSPLsnsq--------ntsQQFPGLTQAALEPILQEMEQI 342 Pacific ...
ESO02390            307 q---------------------------------------------------------qQQLAIMQAKDLATIITNLTEF 329 Helobdel...
WGS:AAPP:GF16655-PA 464 v---------------------------tSESIPAGSGKSQSGA-------------------SQYHIVLKTLLTELAER 497 Drosophi...
Q16ZT4              335 vtsd---------------------siplSSGKHRVIRSHHCTN-----------------------------SKAINDI 364 yellow f...
EDS32659            336 vtsd---------------------siplSSGKHRRLRSQHCTN-----------------------------YKAMGDI 365 southern...
XP_007667852        115 elelavrprsstlnadasspeteqptervlrceypepeetgpppanvtcpsleddfsgsqqdqtsksgslnrqddlavqk 194 platypus
XP_014347179        418 v---------------------------------------------------------eLIAEHLNPNTYTSILQQLADL 440 coelacanth
XP_015782805        328 EGDC-------QRLAEEIEAVKTSLHAEYSLINQSLQEERYKSERL-EEQMNDLIELHQNEIENLKQNIGDMEEKVQYQS 399 two-spot...
CRZ25036            268 KAQN-------QALFEQLNKLQTQNKSEFNYFNSALHEERIKTQRL-EEMLNETIELHQAEMIALKSDLNTIATRMDYQY 339 Brugia m...
Q18025              281 LQHL-------MLIDRKYDRLEDDIKKEIKFYAEALEEERFKTTKL-EEILNEAVELQQAEIATLKEQ-NLMATRVDYQH 351 Caenorha...
EKC40365            343 KESNkllsetvTRLTEELDQCKRWYSTELAALKQVFDEERFKYERL-EEQMNDMTELNQNEFSNLRQDITSMDEKIQYRL 421 Pacific ...
ESO02390            330 QEMQ-------YKLHCSVSTLKTQLDEEGIFCRQALEEEHDRCERL-EEQINDLTELHQNEMYNIKQEMVGMQEKMEYQL 401 Helobdel...
WGS:AAPP:GF16655-PA 498 KAEN-------EKLKERIERLET-GQKEFNNLTATLESERYRAEGL-EEQINDLTELHQNEIENLKQTIADMEEKVQYQS 568 Drosophi...
Q16ZT4              365 RDDY-------DRLKGKLDRLEI-LHKDVSELAMALETERYRAERL-EEQLNDLTELHQNEIENLKQAIADLEEKVQYQS 435 yellow f...
EDS32659            366 RDGY-------DRMKTKLERLEL-MHKDVTDLAIALETERYRTERL-EEQVNDLTELHQNEIENLKQAIADLEEKVQYQS 436 southern...
XP_007667852        195 mndqldvvkmfyssletdfqnlkekylseleqiveclqeekcrRRLmEEQVNDHMQVHLDEILRLKQDLASTEEKMVYQS 274 platypus
XP_014347179        441 KEEQ-------VNLEASFEKLRENYQHENKFLMNSIQEEKHKYRDL-EAQVNDLMDIQQTELMNIKQDLSSMEEKLVYQS 512 coelacanth
XP_015782805        400 EERLRDIYEMLESCQTRISRMEHQQHQHlQqLVNLDSLENSNA--RALVLKLINVLLTILQVVLLLVATVANIVTPFLKT 477 two-spot...
CRZ25036            340 SDRFRSIEENIESTQNKMIRMEVNVKEW------TESRPQTTF--NSVMLSGTNILVEFIKLVLLIVSFALDFVKPFTGT 411 Brugia m...
Q18025              352 NDRFRNVEENMESLQNHLVRIENALMDVrQvKLTSNVW-------QRVALNAGNIVVELLKIALFVVASILDLVRPLTGS 424 Caenorha...
EKC40365            422 DERTTDLQDNVENCQTRITKMELQQQQQ-Q-IISMEMVDNVTF--RTLLTKLINVVLAIVAVVLVVVSTAANLVAPFLTT 497 Pacific ...
ESO02390            402 EERTRDIQELLLTCQTRINKMELQQQQ--QqLISMEGIENTSF--RGLATKLINIVLAVLAVVLVLVSEVANLIGPFLQT 477 Helobdel...
WGS:AAPP:GF16655-PA 569 DERLRDVNEVLENCQTRISKMEHMSQQQ---YVTVEGIDNSNA--RALVVKLINVVLTILQVVLLLVATAAGIIMPFLKT 643 Drosophi...
Q16ZT4              436 DERLRDVYEIMENCQTRISKIEHLSQQQ---YVTVEGIDNSNA--RAVVVKLINVVLTVLQVILLLVATAAGITMPFLKT 510 yellow f...
EDS32659            437 DERLRDVYEIMENCQTRVSKMEHLSQQQ---YVTIEGIDNSNA--RAVVVKLINVVLTVLQVILLLVATAAGITMPFLRT 511 southern...
XP_007667852        275 YEKAKEIWEVMETFQTRISKLEALQQ-----TAQPEMVEKCKTqaQVFLDKFMNLLVTLTNILLVCITSMSCCPLSLIRS 349 platypus
XP_014347179        513 YDRARDLWEVIESFQTRIGKLELQQQ-----AAQLEVLENPST--RAFFAKFMSLVLASITVILVFVSAMTSITIPLVKT 585 coelacanth
XP_015782805        478 RIRFLTTIFILVIVMMFVRQK 498 two-spotted spider mite
CRZ25036            412 RTRAGFVIFFWLALMILThfi 432 Brugia malayi
Q18025              425 RNRSAMAFGLVFLAIFFGHHL 445 Caenorhabditis elegans
EKC40365            498 RARILSSALLVVAIILVGRNW 518 Pacific oyster
ESO02390            478 RLRIVGTALLASLLAILWNRR 498 Helobdella robusta
WGS:AAPP:GF16655-PA 644 RVRVLTTFLSICFVIFVIRQW 664 Drosophila ananassae
Q16ZT4              511 RIRVLTTIICIISIVFIIRQW 531 yellow fever mosquito
EDS32659            512 RIRVLTTVVCIVMLAFMVRQW 532 southern house mosquito
XP_007667852        350 PPRILATLMVIILGAVAWQNW 370 platypus
XP_014347179        586 RLRTLTTIFLLLLGTSYWWHq 606 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap