2XC7


Conserved Protein Domain Family
RNA_GG_bind

?
pfam10258: RNA_GG_bind 
Click on image for an interactive view with Cn3D
PHAX RNA-binding domain
RNA_GG_bind is the highly conserved U3 snoRNA-binding domain of PHAX (phosphorylated adaptor for RNA export) whose function is to transport U3 snoRNA from the nucleus after transcription. It is characterized by having two pairs of adjacent glycines, as GGx12GG.
Statistics
?
PSSM-Id: 313484
View PSSM: pfam10258
Aligned: 61 rows
Threshold Bit Score: 63.3032
Threshold Setting Gi: 118389686
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XC7_A         11 VADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGG-LFIMNGS---RRRTPGGVFLNLLKNTPSISEEQIK 86
gi 122159063  101 SARELAQALDEPKVRLLARAIDALGESTCRAYAEEAVATQRNGG-ELTANGE---RKRTTGGIFWSIVRA--RVDKETYD 174
gi 255074287  133 aARDLCGDLGEPKESLMRRALEVIGVVEANDIAIQVYRIEGEGG-QMTSDGA---RRRTPGGVFWALLR--ERVTKEEWA 206
gi 303280221  144 aARDLCGDLGEPKESLMRRAIECIGIPMANDLAIEVGAIEGGGG-QMTADGS---RRRTPGGVFWALLKT--KVAKEDWD 217
gi 1005966585 114 eARKISNRLKEKRVDLIIRSIKLLGLDEVNKLCSEVMTIEDAGG-LMTRNGN---RRRSPGGVFFHLIKSSGRYAEDIVK 189
gi 586758985   88 FVTNTCRHLGEKKSYLFWEAISCLGLSVLTDLIKEVDVIQDCGG-QLTADGG---RPRTGGGILWNIIKAR---HPTAYK 160
gi 168052709  120 FVVQTCRRIEETKYPLFREAVDRIGIEAMKGLLNQVDAIQKCGG-QMTADGL---RRRSAGGVLWNLLR--DHVGPVLYK 193
gi 145347361  113 LARELAQQLDEPKVRLLARAINELGEAQVRAYVLEAATQQRHGG-EMTALGD---RRRTTGGIFWAIVRA--RTKPEVYD 186
gi 313216584  103 MADEMRFRLWESKLIQLRELIKELGKDKSIEIMEQVTKSELEGG-VFDPARA---QRRLPGGVFIHYIRQRSDVDQEAIK 178
gi 255077239  202 LAERICRRLREHKKHLVRLLIAQFGAALCEGALEETIRVEKNGGsFVTLDGAggvRRRLPGGVFIATVKS--RAPPVEFK 279

                  ....*...
2XC7_A         87 DIFYIENQ 94
gi 122159063  175 EIFAEERE 182
gi 255074287  207 DIFAEEKE 214
gi 303280221  218 FIFeeere 225
gi 1005966585 190 NILKlnq- 196
gi 586758985  161 EIVARGKE 168
gi 168052709  194 EIMKEGNR 201
gi 145347361  187 IIYAEERE 194
gi 313216584  179 NILDKHRs 186
gi 255077239  280 AVMKRAAE 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap