Conserved Protein Domain Family
MIP-T3

?
pfam10243: MIP-T3 
Microtubule-binding protein MIP-T3
This protein, which interacts with both microtubules and TRAF3 (tumor necrosis factor receptor-associated factor 3), is conserved from worms to humans. The N-terminal region is the microtubule binding domain and is well-conserved; the C-terminal 100 residues, also well-conserved, constitute the coiled-coil region which binds to TRAF3. The central region of the protein is rich in lysine and glutamic acid and carries KKE motifs which may also be necessary for tubulin-binding, but this region is the least well-conserved.
Statistics
?
PSSM-Id: 313469
View PSSM: pfam10243
Aligned: 11 rows
Threshold Bit Score: 286.757
Threshold Setting Gi: 124452893
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TDR0        49 MKGLYTDAEMKSDNVKDKDAKISFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLN-KLSSDDAVRR 127 human
Q6PGZ3        49 MKGLYVEAEMKSDNVKDKDSKIAFLQKAIDVVMLVSGEPLAAKPARIVAGHEPEKTNELLQVIAKCCLN-KLSSDEAVKR 127 zebrafish
Q5XIN3        49 MKGLYTDAEMKSDNVKDKDAKISFLQKAIDVVMMVSGEPLAAKPARIVAGHEPERTNELLQLIGKCCLS-KLSSDEAVKR 127 Norway rat
Q9VFL0        53 FDGLYTPEEQMFENITSREDKIRFLQKMIDATKLTTKLDLKVRTSKIVAGQEPELTNELLQAMASVAEK-NLEWDSIVDQ 131 fruit fly
Q24FQ8        50 GQGLYTDQEKDANYYENRDLKILFLRKVIDLIQYTNKSSLQAKPNKIVAGLEPEHTNSFLCELHRVATTpELCQ------ 123 Tetrahymena the...
A0BFP5        56 AKGLYTTDELDGNSYDNKDKKLMFLQKIIDLTSMMLKEEIAAKPGKIAAGLEPENTNLLLQAIYRAAVS-GKNSDPFVKK 134 Paramecium tetr...
Q4CR32        49 PKGLYPDALLDSSNVTEKTIKIEFLTQLIAAVEAGTGKKVAAQPTKIVAGQEAEKTNELLQLLASCAKLtAEQKHAAVQK 128 Trypanosoma cruzi
Q4QC32        48 PDGLFDADQRDSAKVADKKAKVQFLEKLIAAVEAATGTPVAARPAKIVAGEEAEKTNELFQQLARCAALsSAQKAAAVRK 127 Leishmania major
Q17595        46 LKTDFTDDEIKSAG-NDKNTKTAFLDKLIKILD--DGSLKNVKAAKIISGKDAEETNKMLQMLGTNATS----------- 111 Caenorhabditis ...
XP_001358648  54 FEGLYTTEEQQFENIGDREAKTRFLQKMIDAIKLTTKKDLKVRTSKIVAGQEPELTNELLQAMASVAEQ-SLDWQKAVEQ 132 Drosophila pseu...
XP_321700     53 LDGLYTADELNSDNIKDRDSKMAFLQKLIDVVKLTTGRELKVRPSKIVAGLEPERTNELLQALASILEE-KLSTTEIVRH 131 Anopheles gambi...
Q8TDR0       128 VlagEKGEVKGRASlTSRSQELDNKNVREEESRVHKNTEDRGDAEIKERSTSRDRKQKEEL---KEDRKPREKDKD-KEK 203 human
Q6PGZ3       128 VlagDKLDQKGKPS-TSRSQDKENREGREHHRDREERKGIKESSGSREQKDPDQPKDQESKrddKDRRRDAERSDKgRER 206 zebrafish
Q5XIN3       128 VlagEKGDSRGRVLrTSKAQEPDNKSVKEEESRTQK--EEKRSSEVKERSSSAEHKQKEEL---KEDSKPREKERD-KEK 201 Norway rat
Q9VFL0       132 V---VISHSKTPLTlTKPPKETKNSSKNPSPAGKDEDAKRRKEKRISPQE-QKLRKVKEQV---SRSTPPTEKDKA-SQK 203 fruit fly
Q24FQ8       124 -----KGNSIVKKLlAKIEKETQGGGDAGEKPAEKGGEEPQKKPEKKPQQEPPAEQPKPKR---EDPPSQPKVERS-NSK 194 Tetrahymena the...
A0BFP5       135 IlggAGAKEPEPQKkEQPKPEPKAQQPPPKEQSAPQVKDEKRPDEKKPAQPKEDPKPKQQA---QQPPPQQPKENQ-KQQ 210 Paramecium tetr...
Q4CR32       129 A---KGGGSEQPAAdKKAAEQEAKEKEKEKEVEREQKAEERRKRKEEEKRREEEKRREEEKrrgEEKRREEEKRRG-EEK 204 Trypanosoma cruzi
Q4QC32       128 V---SGGGEPAPVAaAAPAPSSKKESG-------------------------------------ETKAPPSETEEErTKR 167 Leishmania major
Q17595       112 ---------------------FNSRNGTGEEKKKKKVKKEDKKGDEEEKSTTKKRSSKKETheeKEKSEKKKSAEE-KEK 169 Caenorhabditis ...
XP_001358648 133 VlmaGTAAATSKPAkEKSKKEPKPSSKQTSPAGKEEETKRVKEKRVSPQE-QKLRKATQAL---ASGVTPTEKEKA-TQK 207 Drosophila pseu...
XP_321700    132 YlgdNPTTTNGVNGnGSGPNAGPETNGTKGETREEGKKSKQERVKEKPKESEATA---------VDPRRKDKNGKV-KEK 201 Anopheles gambi...
Q8TDR0       204 AKENGGNRHREGERERAKARARPDNERQK--------------------------------------------------- 232 human
Q6PGZ3       207 ERTKDRDRDKDKSRDREKDKTREKERERE--------------------------------------------------- 235 zebrafish
Q5XIN3       202 AKEADRDRHREPDRDRNRDGER-EKARARakq------------------------------------------------ 232 Norway rat
Q9VFL0       204 KSKAPKDETKLSRQNSKQKSPSPVKQKSKaklqp---------------------------------------------- 237 fruit fly
Q24FQ8       195 GVGGQVDEPVPVNRQNMRPSSAAKAPPKI--------------------------------------------------- 223 Tetrahymena the...
A0BFP5       211 QVPPPQQQQQQTQEGNVRPSTAKKRPPQ---------------------------------------------------- 238 Paramecium tetr...
Q4CR32       205 RRGEEKRREEERRREEEAAAAAEEGKKKRrkede---------------------------------------------- 238 Trypanosoma cruzi
Q4QC32       168 REEERRRRHEEKKREAEKAKERTAADPPSr-------------------------------------------------- 197 Leishmania major
Q17595       170 KKKSSSSKERHKSSDRSSEKSSEKSSKEKkkeks---------------------------------------------- 203 Caenorhabditis ...
XP_001358648 208 KTKATVGDPKPSRQGSKQKSPSPVKQKAKtkgqgsiesdtmspvpvpvakkpspeavpkksspeavpmkaspdvvpkkss 287 Drosophila pseu...
XP_321700    202 EVLKNGTTVKPVEKAKTKQNGTKVQPN----------------------------------------------------- 228 Anopheles gambi...
Q8TDR0       233 -------DRGNRERDR-DSERKKETERKSEGGKEKERLRDRDRERDRDKGKDRDRR-RVKNGEHSW-------------- 289 human
Q6PGZ3       236 -------KDRNREKER-ERDKDRDKKKERESHKDRERDKDREREKRREKEKDKERP-RETEEKLKD-------------- 292 zebrafish
Q5XIN3       233 -----drDRNNKDRDR-ETERDRDRDRRSDGGKEKERQKDRDR----DKGKDRERR-KSKNGEHTR-------------- 287 Norway rat
Q9VFL0       238 ---stesDNLSQSMSPvEEGSTKPAASESAPSKPEPEMVPPLKEKEAVVRPVQETP-TAPPAEPES-------------- 299 fruit fly
Q24FQ8       224 ---------ANNVKVAdTQSKGKGTTGVIVDRGDKDEDDQNEAEQADNRGSQPENA------------------------ 270 Tetrahymena the...
A0BFP5       239 -----------------LPSNQVQVEQNQKKGGTANVIIEGKGNNDEDDGIVVQSN-VRPTSDI---------------- 284 Paramecium tetr...
Q4CR32       239 ---slpvGESPKVEQ--QRQEAANASGKQQKSGEPHGSHNEEKEGKKKHGETLEERtQKTGDEERR-------------- 299 Trypanosoma cruzi
Q4QC32       198 -----------------TKEETKQAAATAASGETERHRHREERKRESTEAVDTATT------------------------ 236 Leishmania major
Q17595       204 ---ttdeKPKKSKKDPsERHFKRQDSMIAVNGDAPDTPNNENGDEGYDDHEISEPTvISNMETDLS-------------- 266 Caenorhabditis ...
XP_001358648 288 pesvpkkGSPEVAPKKaSPEVAPKKASPEVAPKKSSPSSSPKVSKEAVAEPAMETNlTAPPTESES-------------- 353 Drosophila pseu...
XP_321700    229 -------DSTKKKSDKpSKGKEKEKSVKRISSIPEEPQPPAVPEKVTPARPEPTTN--GTESMVNGgnapesrkrrdsik 299 Anopheles gambi...
Q8TDR0       290 -----------------------------------DLDREKNREHDKPEK------KSASSGEMSKKLSDGTFKDSKAET 328 human
Q6PGZ3       293 -----------------------------------RGDRKIKAAEEISKS------KPQPEVASRTHQAETEEAESPSRI 331 zebrafish
Q5XIN3       288 -----------------------------------DPDREKSRDADKSEK------KADISVGASKSSTLKASKRRSKNS 326 Norway rat
Q9VFL0       300 -----------------------------------RKSSSRSRRSSGSHR------QPEPNPIPNESQSQPAVQSSETSS 338 fruit fly
Q24FQ8           -------------------------------------------------------------------------------- Tetrahymena the...
A0BFP5           -------------------------------------------------------------------------------- Paramecium tetr...
Q4CR32       300 -----------------------------------KRHEERRRREKEAAE------REE----IPTADESLTTVTRAPRV 334 Trypanosoma cruzi
Q4QC32           -------------------------------------------------------------------------------- Leishmania major
Q17595       267 -----------------------------------AQSLLIQQPVTSPLK------TDDSGMGESPRMIKPEDRPPLIRP 305 Caenorhabditis ...
XP_001358648 354 -----------------------------------RKSSSKSRRSSASQR------QVQAEPEQPAPNEVKTQQQQQPEP 392 Drosophila pseu...
XP_321700    300 efgepvtlsdangeasgeeehekrrqqqlgsnsssRRSSLKKQNSLTPSEnnalseMNQFNGLQSSLSRQDSNVTVTVAA 379 Anopheles gambi...
Q8TDR0       329 ETEISTRaskslttktskrrsknsvegrkednisaksldsivsginnepnqetttseigtkeaninstsisddnsaslrc 408 human
Q6PGZ3       332 PRPSSAKgqrrkpktggqgteqdetesege-------------------------------------------------- 361 zebrafish
Q5XIN3       327 LEGRKEDnisakildsivsglndepdqettapeiddnsaslwrena---------------------------------- 372 Norway rat
Q9VFL0       339 PPETNSGeakrevpltr--------------------------------------------------------------- 355 fruit fly
Q24FQ8           -------------------------------------------------------------------------------- Tetrahymena the...
A0BFP5           -------------------------------------------------------------------------------- Paramecium tetr...
Q4CR32       335 EQRV---------------------------------------------------------------------------- 338 Trypanosoma cruzi
Q4QC32           -------------------------------------------------------------------------------- Leishmania major
Q17595       306 MTGAGGG------------------------------------------------------------------------- 312 Caenorhabditis ...
XP_001358648 393 SQQADSNnnqdvrpmaapl------------------------------------------------------------- 411 Drosophila pseu...
XP_321700    380 PVESKASavkppmhrq---------------------------------------------------------------- 395 Anopheles gambi...
Q8TDR0       409 eniqpnptekqkgdstsdaegdagpagqdksevpetpeipneLSSNIRRIPRPGSARPAPPRVKRQDSMEALQm-DRSGS 487 human
Q6PGZ3       362 -------------------aegpsaekpiplengdvtdpaalQTTHSRRLPRPSSARPAAPRVKRQESYTDATpaERLGS 422 zebrafish
Q5XIN3       373 ---epepavkqkgdspsdaegeavptsqdklevtenaevsneLPSSLRRIPRPGSARPAPPRVKRQESTETLAg-DRSGS 448 Norway rat
Q9VFL0       356 --------------------------------enskevnqrpRTSLRPPSARPASARPGAPR--RRNVEIVLQpnDQIKM 401 fruit fly
Q24FQ8       271 ---------------------------------------------------------------------------GGKGV 275 Tetrahymena the...
A0BFP5       285 ---------------------------------------------------------------------------NAQEY 289 Paramecium tetr...
Q4CR32       339 ------------------------------------------ASTAPTPNAAASAAGKAPPRTKPTHEVVD----GSQLD 372 Trypanosoma cruzi
Q4QC32       237 ------------------------------------------------------SARKAPPRPKPTHEVIEAQ--NAAAD 260 Leishmania major
Q17595       313 ------------------------------------------RPMTSMGRPGTAASRPAPPKLKKKQIATVDS--TPQVV 348 Caenorhabditis ...
XP_001358648 412 ------------------------------trensketnqrpRTSLRPPSARPASARPGAPR--RRNVEIVLQpnDQLKM 459 Drosophila pseu...
XP_321700    396 ---------------------------------qsvetvmrpRTSLRPPSVRPPSARPGAPRRKEKNVEVILQpnETQKL 442 Anopheles gambi...
Q8TDR0       488 GKTVSNVITESHN------SDNEEDDQFVVEAAPQLSEM---------------SEIEMVTAVELEEEEKHGGL-VKKIL 545 human
Q6PGZ3       423 GKTPASVILDGKKls---eDEDDEDGQFVVEEAAPPPSD---------------VPEVESNSLELQGDDKHGGL-VKKIL 483 zebrafish
Q5XIN3       449 GKTVSTVIIDSQN------SDNEDDEQFVVEAAPQLSEI---------------AEIEMVPSGDLEDEEKHGGL-VKKIL 506 Norway rat
Q9VFL0       402 SGI--NVKLETFG------DLDDDGENLVIIEDSAAHDI---------------VEGGGDEPALEGQLDAQGRL-VQQIL 457 fruit fly
Q24FQ8       276 SKFTNQALNDNLGiv---pSAQKDQGG--------------------------------------EEGDNQGGIkFKRKI 314 Tetrahymena the...
A0BFP5       290 GKFVRDNMKNQEK------AKEEEKE---------------------------------------KDQPQEGIK-MKRIG 323 Paramecium tetr...
Q4CR32       373 AVPVSGVIREKKRtpggkaQEAEDESEWMRVAEQQNAKT---------------VTSGSGDGGGVNEAEAKGYL-GQQAL 436 Trypanosoma cruzi
Q4QC32       261 ARPAVGVIREGKRgkadteSEDEEKEDWQKVAEQYEVKP---------------AARTAAVA---EDADVKGLL-GQQAL 321 Leishmania major
Q17595       349 VELKSEIISDAPK------VETEDDSNFIMENDEEDGDR---------------TARIEDL----VDEEDRGAL-VQKIM 402 Caenorhabditis ...
XP_001358648 460 SGI--NVKLETFG------DLDDDGENLVIIEDANAHDI---------------EKGAAEEPLLEGQLDAQGRL-VQQIL 515 Drosophila pseu...
XP_321700    443 GEI--NVKMEVFN------SELLDDDGENLIVIEDPTTVsdglvygragelpggAADETALLQSAEQEEQQGHL-VQQIL 513 Anopheles gambi...
Q8TDR0       546 ETKKDYEKLQQSPKp---GEKERSLF------------ESAWKKEKDIVSKEIEKLRTSIQTLCKSALPLGKIMDYIQED 610 human
Q6PGZ3       484 ETKKDYESSPSSKS----KEQDRSLVs-----------EASRKKERELVAREIERLRSSIQTVCRSALPLGKIMDYIQED 548 zebrafish
Q5XIN3       507 ETKKDYEKLQQSPKp---GEKERSLIf-----------ESAWKKEKDIVSKEIEKLRVSIQTLCKSALPLGKIMDYIQED 572 Norway rat
Q9VFL0       458 ETQKELVNQGAEVEp---PP---------------------AQAGRQTSARQVNDVRDVVQKLTKSIGPLGKLLDCIPED 513 fruit fly
Q24FQ8       315 GNQKPTIGGSTTATa---GGTTAVLQ------------GAS-------SGADISALTQMVQEIAKNVNPLGKSLEFIADD 372 Tetrahymena the...
A0BFP5       324 NVNQRKDKIKEEI----------------------------AQNLGTSQVSDTIVMQKLIQSMSQNVNPLAKQIEFIQDD 375 Paramecium tetr...
Q4CR32       437 KAKREQEEETARRAq---EANARALQggssgggiiihsSKGGKSGAAVAESELSKLREQLQLLTKASNPLGKLLEAIFDD 513 Trypanosoma cruzi
Q4QC32       322 KAKREQEAAARRAEvtgdGAAAATPAgggiiihsskntASRGGGSHALGDSDLNQLREQLQLLTKASNPLGKFLEAIHDD 401 Leishmania major
Q17595       403 ETKAEIEDGGGQDQv---EESD-------------------ADKIMTVEREKMKQLQEKLQDLTRSAYPLARLFDFANDD 460 Caenorhabditis ...
XP_001358648 516 ETQKELVQQSAEAEq---PATQP------------------NQGTRQSSARQVNDLRDLIQSLTKAVNPLGKLMDFIPED 574 Drosophila pseu...
XP_321700    514 ETQKEFSTHTGTDSe---LLRKADM--------------EWTAGQRQSSARQMESLRESIQKLTRSVNPLGKLMDFIQED 576 Anopheles gambi...
Q8TDR0       611 VDAMQNELQMWHSENRQHAEALQQEQRITDCAVEPLKAELAELEQLIKDQQDKICAVKANILKNEEKIQKMVYSI 685 human
Q6PGZ3       549 MDSMQNELQSWRKENKENAQALLQEQRITDGVVEPLKVELAELEQLIKDQQDKICAVKSNILKNEEKIQKMVSSI 623 zebrafish
Q5XIN3       573 VDAMQNELQLWHSENRQHAEALSKEQSITDSAVEPLKAELSELEQQIKDQQDKICAVKANILKNEEKIQKMVHSI 647 Norway rat
Q9VFL0       514 FDAMQLELTMWRDTYTQASTELKREQTLTASATEPLQHQLQQIQASIAEYRELIDESRHKILQNNARILKLMMEQ 588 fruit fly
Q24FQ8       373 IESMNHELDYWTKQYKQYKEKMQNELKVTDEMLQPIQDQIAEIEEKISDKRNKISNVKAQLIKNQSQIQTLLYSV 447 Tetrahymena thermoph...
A0BFP5       376 IENMNRELQQWRKIYNVSKQKMVDMNRATEEAQQPLYDKIAEVEEVIKEKKSKIQNIKAQIIKNKLQIDQLLKAV 450 Paramecium tetraurelia
Q4CR32       514 IDTMARELEMWRSEARSQALAAADARRETMESLQEVNAQLQNLEDAINDQILKTHNIRRSVINNGNAIAGMVRMI 588 Trypanosoma cruzi
Q4QC32       402 IDSMTRELEMWRSESRNQALAAAEARRQTEESLQEIHANLQNLEDAISDQVLKTNNLRQTILANDAAMEVMAKTI 476 Leishmania major
Q17595       461 IESMIKELERWRSEQRRNEQEDQNKKAAGFGDSSRLYNIIANLQKEINDTKEELSKARGRVLNNEKRIQLFISNV 535 Caenorhabditis elegans
XP_001358648 575 IDAMQLELTMWRDTYTQAATELKRERSLTASATEPMKDQLMQIDASIVEYEELIDESRQKILQNNARILKMLMEQ 649 Drosophila pseudoobs...
XP_321700    577 IDSMERELASWQQIYTQSMVELNKERSATENAIEPLKQQLSQIEVNIKEYRDMIDTTRANILQNEAKIERLYMTE 651 Anopheles gambiae st...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap