Conserved Protein Domain Family
Atg14

?
pfam10186: Atg14 
Vacuolar sorting 38 and autophagy-related subunit 14
The Atg14 or Apg14 proteins are hydrophilic proteins with a predicted molecular mass of 40.5 kDa, and have a coiled-coil motif at the N-terminus region. Yeast cells with mutant Atg14 are defective not only in autophagy but also in sorting of carboxypeptidase Y (CPY), a vacuolar-soluble hydrolase, to the vacuole. Subcellular fractionation indicate that Apg14p and Apg6p are peripherally associated with a membrane structure(s). Apg14p was co-immunoprecipitated with Apg6p, suggesting that they form a stable protein complex. These results imply that Apg6/Vps30p has two distinct functions: in the autophagic process and in the vacuolar protein sorting pathway. Apg14p may be a component specifically required for the function of Apg6/Vps30p through the autophagic pathway. There are 17 auto-phagosomal component proteins which are categorized into six functional units, one of which is the AS-PI3K complex (Vps30/Atg6 and Atg14). The AS-PI3K complex and the Atg2-Atg18 complex are essential for nucleation, and the specific function of the AS-PI3K apparently is to produce phosphatidylinositol 3-phosphate (PtdIns(3)P) at the pre-autophagosomal structure (PAS). The localization of this complex at the PAS is controlled by Atg14. Autophagy mediates the cellular response to nutrient deprivation, protein aggregation, and pathogen invasion in humans, and malfunction of autophagy has been implicated in multiple human diseases including cancer. This effect seems to be mediated through direct interaction of the human Atg14 with Beclin 1 in the human phosphatidylinositol 3-kinase class III complex.
Statistics
?
PSSM-Id: 337663
View PSSM: pfam10186
Aligned: 29 rows
Threshold Bit Score: 138.327
Threshold Setting Gi: 74582122
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4WCL3         3 CPICSR-VSssrLRFYCPTC---ACN--------------QIYTLRIDNARALLEKETLGRQVEkallhqtsptlsyhrf 64  Aspergillus fum...
Q9VAP6        70 CPLCHScSA---SRFHCRNC---VRNgniths--qaerpeSLTEKQQRYINLQAGLKTFSTRYErligq----------h 131 fruit fly
Q17M47        35 CPLCNY-SK---RHFHCKSC---IRKgdfihs--thhileRFSEKQLRHMNLKSAHATLEGKCVkller----------r 95  yellow fever mo...
Q6ZNE5        43 CPLCNT-TR---RRLTCAKC---VQSgdfvyf--dgrdreRFIDKKERLSRLKSKQEEFQKEVLkameg----------k 103 human
Q54QH5         7 CCSCNN-RFn-fQESYCEPClqrIKNdq-----------sRVFELIQSIFDKKKANLIAKNKILesis------------ 61  Dictyostelium d...
O42862         7 CQLCET-R----RPSICESC---LKKqlydfyhkrdefsrDIESELEKVAKLKSESFSLKGKITqkee------------ 66  Schizosaccharom...
Q6FX35         5 CPICET-QS---HVFYCAHC---INSsp-----------dLLIRLKFDLYILGKINNALRNKVDqyleevdde--lntni 64  Candida glabrat...
XP_001779720   8 CGICES-VN---LPSVCSAC---INY--------------RLLERYKLLKNLAQGRDFLRQRLDekli------------ 54  Physcomitrella ...
XP_001628618   3 CPLCLR-RS---KYLTCCSC---LRSgsvtht---gkrpeSYCEKVKRLADLKHVKEAFQKRVTeeian----------r 62  starlet sea ane...
XP_320296     43 CPLCGA-HR---RHFHCKSC---IRHgdflhtavycqlpeRFGEKQQRLRNLRTANATLESKGSlmlek----------l 105 Anopheles gambi...
Q4WCL3        65 eecsTQSPDKVPSPQDVLQIITAKAESSIR----------RKELALQIQQLKSEIKDRQLGISQRRLTLA---------- 124 Aspergillus fum...
Q9VAP6       132 rsneDRLMAIKAKRKQLELLQQLISGTGQR----------LRVLGERRDELRRANAEKRKNLPKYPDKVKmlenyvldrv 201 fruit fly
Q17M47        96 rlscQLRAEIKQRTENIDNIRKLMALKREN----------VGRLQALRKELYESNRLLRMKLPRCDDQVKrissyvlskl 165 yellow fever mo...
Q6ZNE5       104 witdQLRWKIMSCKMRIEQLKQTICKGNEEmeknsegllkTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGdl-------- 175 human
Q54QH5        62 qpknQLQEQIDIKKTYLESKKIQIEILKNK----------IQTLKTTVIKDNGLIDVKKKYLSTRRSSLK---------- 121 Dictyostelium d...
O42862        67 -----ltyRLQNLAASLNEKKSLSCDLHSR----------KQLIEDDLSNRKKSINIASQKLAGLSHSTSdyfsk----e 127 Schizosaccharom...
Q6FX35        65 rngeQLESNIGVQILKERLGKVQVLRKERQ----------NNKIKHKISQQDRRIKEKSRYIAELRSLI----------- 123 Candida glabrat...
XP_001779720  55 ------------akreAELQQHWRVEHAER----------RAQLKERLRQCKEDFIQGKMKRDLMQHDLD---------- 102 Physcomitrella ...
XP_001628618  63 qavqQLNDAVILKREKISCIQSVIRLIQQH----------TSQDQQSLDSIRKSNAVKKVKLKSNADEIKtllevkkkhl 132 starlet sea ane...
XP_320296    106 hqagRLAGEIKQRSDKADIIRKTIELKRIA----------IEELRLKQRHLGDAIRKLRITLPRYDDKVKtlsefvagkl 175 Anopheles gambi...
Q4WCL3       125 ----RRRSDAESSKFQLESREVALICGVQNTIK----------------R-TERL------------WHSLHSKTVEA-- 169 Aspergillus fum...
Q9VAP6       202 ekieKLRETHLGLLDSIKQAARRSIQQLVTYVF----------------P-IAEV---------------VLKEEQQRra 249 fruit fly
Q17M47       166 eeseRRRASINELQDEIKQFRRDQIGKLIRYIF----------------P-ISRA------------ISNRSGFSSS--- 213 yellow fever mo...
Q6ZNE5       176 --veKKTIDLRSHYERLANLRRSHILELTSVIF----------------P-IEEV------------KTGVRDPADVSse 224 human
Q54QH5       122 ---------KNKISFEAVNNSKSGFSSLTDEIQ----------------K-KKDQ------------LTAENTSLQIV-- 161 Dictyostelium d...
O42862       128 yltaYRRSE--LLQNKLHEYQKKLITRVLDMYQlhwqrdlvlntqgctqK-SAQM------------GSEFNPDSIDSsl 192 Schizosaccharom...
Q6FX35       124 ------------NGPPKNQNRFTDPQTILKAQK----------------Q-LQDK------------LEIAKRLSIQT-- 160 Candida glabrat...
XP_001779720 103 ----AQVRFLSAASAQVATKRLELLAHFYPDLI----------------RaQSLV------------HTAVASDLYQK-- 148 Physcomitrella ...
XP_001628618 133 atlsKRMRDLKSLQNELGQVRQRSMALVQKYLF----------------P-IQAIpvypvmgtppppQHTPESLDLSR-- 193 starlet sea ane...
XP_320296    176 eeseHRKARLAAVQERLRQRKRDQVQQLVRIIF----------------P-ITQT------------IASRSSLTGS--- 223 Anopheles gambi...
Q4WCL3       170 ---RIF-----LCREVANLYSLRQwm----------kqDGSEMKETYVIGG--VPIVDLRDLNGksqncpllldm----- 224 Aspergillus fum...
Q9VAP6       250 sveRTE-----EAETIAALADAKNtsyirg---kwvfhGSGISEVQYRIVG--PSLPANGDYTAyldwladnkddv---- 315 fruit fly
Q17M47       214 ---DGE-----SKHTISEISDATRtayvrg---kwvlqDS-FGEIQHIIVA--PALPGNGNYSAyndwatvnpatdvss- 278 yellow fever mo...
Q6ZNE5       225 -sdSAM-----TSSTVSKLAEARRttylsg---rwvcdDH-NGDTSISITGpwISLPNNGDYSAyyswveekkt------ 288 human
Q54QH5       162 ---KRS-----KIEQLTNSMTRLQ--------------LNPTTPDHFFLFN--MVLNDQQLLK----------------- 200 Dictyostelium d...
O42862       193 -ayRLS-----KLSMGNSKSDLSHsdnetghfysnffsQVMELNASVTISG--IPVCIRSKEKM---------------- 248 Schizosaccharom...
Q6FX35       161 ---RSE-----KLAMLNKWYSIRK---------------RDSHDIPFTISY--QPVISLKNFNR---------------- 199 Candida glabrat...
XP_001779720 149 ---RRM-----VIRQLCKILPLRRss----------weGSCSGPQSVRICG--ARLPLGDDPLT---------------- 192 Physcomitrella ...
XP_001628618 194 ---ELSfedqaDASVESALAEATQtsyv------qgkwVNETATLELSIID--SSLPWSGDYSAyrhwvkahkng----- 257 starlet sea ane...
XP_320296    224 ---SST-----ASSGSSACGGATRtayvrg---qwilqDS-FGEVQHVIVA--PALPGTGNYSAynewatgggdgggava 289 Anopheles gambi...
Q4WCL3       225 ------------papsinaqigATAVQISTSFSNIAHLLVLVSHYLSLRLPAEITLPHKDHPVPTIHAPIASYISRESIL 292 Aspergillus fum...
Q9VAP6       316 ----------pkataneitpsrFEAYRIVGALTYTAQLTQLLSFYLNVRLPHKIAYGDFCR------------------- 366 fruit fly
Q17M47       279 --------tgrsedgvrnvasrNPAHTIAAALTYTAQLVHIVCFYLDIRAPYKVSYSDFCT------------------- 331 yellow fever mo...
Q6ZNE5       289 -------------tqgpdmeqsNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCG------------------- 336 human
Q54QH5       201 ----------------------FPKDVIFTTLGYISKIVVLISGILGITLPYHLLSKGSKSTI----------------- 241 Dictyostelium d...
O42862       249 ----------------------FLNPDCALTLSFICIFLA---QYTSIPLPCPLQLPSPDQ------------------- 284 Schizosaccharom...
Q6FX35       200 ----------------------LPLPLIEGSLRKLIQYMNLLEHIYCIKYPSAMFVHEDEM------------------- 238 Candida glabrat...
XP_001779720 193 ----------------------TPHMELAASLGYMVQLVSLAARYISGPLLHSSGFAASSSRVWQRSSYFDSRPASRSEE 250 Physcomitrella ...
XP_001628618 258 -----------skgpdddvglrNPAYTISSALTHAAQLLELLASLLDVNLPSKLSYSEFCQNemgrkefqsalsrlntnv 326 starlet sea ane...
XP_320296    290 sasstaastmeasaspakvgshNPAHTIAAALTYTSQLVALLGYYLDVRLPYRVSYADFCT------------------- 350 Anopheles gambi...
Q4WCL3       293 TATStq-----------pHNLASSTTHPLGFQSNHYQPRPLTIDRSLPKL--AR--EDPESYVLFLEGVTLLAWNVSWLC 357 Aspergillus fum...
Q9VAP6       367 ----------------------------------------K-----------------LLNEEQFRRKISRLNSNIMYLA 389 fruit fly
Q17M47       332 ----------------------------------------T-----------------ALSEAQFNRKVARLNANILYLC 354 yellow fever mo...
Q6ZNE5       337 ----------------------------------------E-----------------NLSKQKFTRAVKKLNANILYLC 359 human
Q54QH5       242 --------------------------------------HHNMKSKDYPLY--YQ---QKTKSREFQKALHLLGENIIFLR 278 Dictyostelium d...
O42862       285 ----------------------------------------------------------KPMTSFSSEQMLYIMYNIVWIS 306 Schizosaccharom...
Q6FX35       239 ----------------------------------------------LSLQ--GHsaKLKRNAPELLQVLIKLIQMILVVM 270 Candida glabrat...
XP_001779720 251 FPLFiprkggctssgddnELSKSVGSTLGFSSMESPRIDTVESTASLVNYgtSS--GTRESYPDVQKGIKLLRRSVGCLC 328 Physcomitrella ...
XP_001628618 327 lhlcftqhvdptllhphrtlnnlyalinttctgrggpfeyhpellstdnesaedrpsdfessseedgdsdteadwetlpk 406 starlet sea ane...
XP_320296    351 ----------------------------------------T-----------------TLSEAQFARKVARLNADIVFLC 373 Anopheles gambi...
Q4WCL3       358 RTQGLNI--------ASDSWEEI---------------------------CNIGKNMW----------------QLLVA 385 Aspergillus fumi...
Q9VAP6       390 YTQQVKLral----ieqHTLENL------------------------------LAILD----------------LERSD 418 fruit fly
Q17M47       355 YTQGCQLnel----rptHTLENI------------------------------QRLMN----------------STHAD 383 yellow fever mos...
Q6ZNE5       360 FSQHVNLdql----qplHTLRNL------------------------------MYLVS----------------PSSEH 388 human
Q54QH5       279 YYHGIQTp-------KESNLLFL-------------------------------KNIY----------------ELIKS 303 Dictyostelium di...
O42862       307 WNCGIFSfprgitqsQLFELMQYtgfwlvqlrtkpltsqkpdwhykmgmdFDLFHRLYlarlpipinysslrsrSSSKP 385 Schizosaccharomy...
Q6FX35       271 TRSKLIDerk--qniDYAWILDQ---------------------------YDIDGLFY----------------HMAMS 304 Candida glabrata...
XP_001779720 329 AY-GFGQlsls-vptDMSIFDAF---------------------------AELLNILS----------------Sketr 362 Physcomitrella p...
XP_001628618 407 nveipdtppfggtntsftesitsrsmtshstsssehetdarqnetsmslvssavsalwnwknnrd-------------- 471 starlet sea anemone
XP_320296    374 HTQGCRLndm----nptHTLENL------------------------------LCLLK----------------SPELG 402 Anopheles gambia...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap