Conserved Protein Domain Family
SMP_2

?
pfam10144: SMP_2 
Bacterial virulence factor haemolysin
Members of this family of bacterial proteins are membrane proteins that effect the expression of haemolysin under anaerobic conditions.
Statistics
?
PSSM-Id: 370829
View PSSM: pfam10144
Aligned: 25 rows
Threshold Bit Score: 162.418
Threshold Setting Gi: 81544476
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCH:MU9_821        1 MAKTKLTFRLHKTAIILICLALMVCL-LQGVSYFSRVHQQSSMDQFNELAYSLAQQVAFNLSDAIDDNGKvlnKKQITAN 79  Morganella ...
jgi:Asuc_2111      3 LVKEKILKSALLTVIIALCAAVMALI-LFGVKQFQTGSQLAGVNQVANLSHLLVRQQTNLFSMLLQNNAN---GATLTES 78  Actinobacil...
USMARC:WQG_18610   3 inrektIKFSIIGLVFVFCFAIVALI-LNGINQFKAGSQLATVNQVSHLSHLLVRQQANLFSLILMKNAR---HEEINEA 78  Bibersteini...
ACL32711           3 isREQLIKSSIIAVIMAICLMIVWII-LTGINHFKVGSQLAGINQVTNLSHLLVRQQAKLFSLMLVKNAK---NDELVEA 78  Glaesserell...
Q7VNW6             3 LTREKVIKTTLLAGIIVVCVMIVSVI-LNGVNQFKLGSQLASVNQVSNLSHLLVRQQAKLFSLMLVKNVN---NDELIEA 78  [Haemophilu...
18221:APL_1229     3 vTREKLIKFGLLAGISVLCVMIVSVI-LSGINQFKLGSQLASVNQVSNLSHLLVRQQANLFSMMLVRNVK---SEDLVEA 78  Actinobacil...
Q9L8J3             3 lTKEKFIKLSMISSIIILCIAIVSVI-LFGVQQFKIGSQLASVNQVSNLSHLLIRQQANLLSMLLVNNAS---TEQLTES 78  Pasteurella...
Q65RP6             3 IIKEKLAKSLMFVVIIALCITVMSII-LFGINQFKIGSQLASVNQVSNLSHLLVRQQANLFSMLLVNNAG---NEQLTDN 78  [Mannheimia...
Q9KPM1            22 mdgslfsFRVVVRVATVLAVAVMFFItIQNSVVISKGNERIQANQLETLTKVLITQAAMSAGSMIADQDQ----ERLLAL 97  Vibrio chol...
WP_006249601       3 ISREKITKTLLLAGITLLCCGIVAVI-LMGVNQFKLGSQLASINQVSNLSHLLVRQQANIFSFLLVKNAK---TDELVDA 78  Mannheimia ...
CCH:MU9_821       80 LAQLTTNSRILDATVYQDDGVQIAGSGESITVRDRLALDGQKAGSY--FNHQIVAAIPGKKGPKGFLRLTIDTHRLATES 157 Morganella ...
jgi:Asuc_2111     79 LDKLINDDMVLDASLYANNGELLAQSTASLNLRRRLGLGADESE----RVQQIVEPIYAENSVIGFLRVSFDGRYGQATQ 154 Actinobacil...
USMARC:WQG_18610  79 LEHFAKEDFVIDASLYSTNGTLIAQSSNALSFKVSELAQINT-------TQQIVEPIFIQQELSGFLRVTFNAEYGQTTR 151 Bibersteini...
ACL32711          79 LDVFAKEAFVIDANLYSPSGNLVAHSSNAIEFNPRVNDKIQQEPA---LTQQIVEPIFAQDDLIGFLRVTFDSQYGQTTQ 155 Glaesserell...
Q7VNW6            79 LDAFAKEEFVIDANLYAANGSLIAQSHNALQFKKLLLEEGSQP-----LTQQIVEPILTQQNLIGFLRVTFDSQYGQTTQ 153 [Haemophilu...
18221:APL_1229    79 LDAFSKEDFVIDANLYSPAGVLIAQSRNALEFKSLLQQDKAQP-----ATQQIVEPIFSQQDLVGFLRVTFDAQYGQTTK 153 Actinobacil...
Q9L8J3            79 LDAFAKEEFVLDASIYSNRGELLAHTSHFQNLRLTLGLNSPTQPDEe-NTQQIVEPIYSLNGIEGFLRVTFDSKYGKTTQ 157 Pasteurella...
Q65RP6            79 LENLTKDKFVLDASIYGKNGELLAQTRNTLDLREQLGLNEESSKHHvvNRQQIVEPIYSPNGIEGFLRVTFDSKYGQTTQ 158 [Mannheimia...
Q9KPM1            98 TNQLATDRLVFDASIYDSEGVLLAASESALSVREVLGLDTPLHTASi-GRQQLVEPVVHDGSLIGFVRITFETG------ 170 Vibrio chol...
WP_006249601      79 LDSFAKEDFIIDANIYSPNGVLLAQSQNAKDLKVLLDSEQ----SA--KTQQIVEPIFSQQALVGFLRVTFDAEYGQTTK 152 Mannheimia ...
CCH:MU9_821      158 TQVDN 162 Morganella morganii subsp. morganii KT
jgi:Asuc_2111    155 SKVSQ 159 Actinobacillus succinogenes 130Z
USMARC:WQG_18610 152 NKINa 156 Bibersteinia trehalosi USDA-ARS-USMARC-192
ACL32711         156 HKVNe 160 Glaesserella parasuis SH0165
Q7VNW6           154 SKIEQ 158 [Haemophilus] ducreyi
18221:APL_1229   154 SKVEr 158 Actinobacillus pleuropneumoniae serovar 5b str. L20
Q9L8J3           158 SKIDh 162 Pasteurella multocida subsp. multocida str. Pm70
Q65RP6           159 NKINQ 163 [Mannheimia] succiniciproducens MBEL55E
Q9KPM1           171 -KVTA 174 Vibrio cholerae
WP_006249601     153 ARVEQ 157 Mannheimia haemolytica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap