4D18


Conserved Protein Domain Family
CSN8_PSD8_EIF3K

?
pfam10075: CSN8_PSD8_EIF3K 
Click on image for an interactive view with Cn3D
CSN8/PSMD8/EIF3K family
This domain is conserved from plants to humans. It is a signature protein motif found in components of CSN (COP9 signalosome) where it functions as a structural scaffold for subunit-subunit interactions within the complex and is a key regulator of photomorphogenic development. It is found in Eukaryotic translation initiation factor 3 subunit K, a component of the eukaryotic translation initiation factor 3 (eIF-3) complex required for the initiation of protein synthesis. It is also found in 26S proteasome non-ATPase regulatory subunit 8 (PSMD8), a regulatory subunit of the 26S proteasome.
Statistics
?
PSSM-Id: 313324
View PSSM: pfam10075
Aligned: 34 rows
Threshold Bit Score: 98.4906
Threshold Setting Gi: 224495933
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4D18_H        35 IATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALR 114 human
Q1HQV1        99 KNKYQLLGMNLLFLLSQNRVAEFHTELELLPADIIQSNEYIRHPLALEQYLMEGRYNKIFQ-AKGNAPSERYNFFTDILL 177 yellow fever mo...
Q9VUJ4        98 KHMYKFMGLNLLYMLATNRLADFHIELERLPTALLLHDSFIQPVLALENYYMEGRYNKILQ-AKKSMPSEIYSNFMDILV 176 fruit fly
Q9V436       101 ESKYKLLGLNLLYLLSGNRVSDFHTELELLSVDVIQHNQFIRPILALEQYIMEGRYNKIFQ-AKSTVPVEVYSYFMDLLL 179 fruit fly
Q3SYT7       123 AYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFL-AKGNIPAESYTFFIDILL 201 cattle
Q4DWI7       110 PLYLLILGLNLVRLLVRNRIAQFHSELEKIPNQIHGTNTYIRFAVLLERYLMEGSYKKLLN-SRHQAPSNEYIPIVGMLE 188 Trypanosoma cruzi
XP_002631070  87 ENKHLMTGLHLMFLLASNRLSDFHMLLEQVPQKEQTSNAYISTPVRIEQSLMEGAYNKVVLT-EKNIPNPSYSVFIRIML 165 Caenorhabditis ...
XP_001419672 110 qNEALIVGLNLLRLLVQNRIAEFHAELETTDDDVLK-DQRVQAVLELEQFLMEGAYNKIAQRQNAL-PDPSYEYFMSMLM 187 Ostreococcus lu...
XP_001303166  85 ERMPLLVSINLIHLLATNDISEFQIEY-QHAKDLIGNNKYLSYVTEVYRLLADNSFTRLFPII-AAPPSDLFTQFASDLL 162 Trichomonas vag...
XP_001581925  98 PKMEILIGVYLIALLAENRTADFNVSY-DAALLLLGQHPTLEYAATMYKAISDNSFATIYS-LKSNPPHQLYDYITSNII 175 Trichomonas vag...
4D18_H       115 DATRRRAFALVSQAYTSIIADDFAAFVGLP--VEEAVKGILEQGWQADSTTRMVLprK 170 human
Q1HQV1       178 QTVRDEIGACLESSYERVSLQEAAKRLNLKt-KDEVKEFAEKKGWKLGSDGF-YHfiS 233 yellow fever mosquito
Q9VUJ4       177 NTAREEIASCMEKSYLKMAPKLAAQRLGLRpgSKELFELATKRQWCLDEEGN-YDyaG 233 fruit fly
Q9V436       180 ETVRDEIGACIEKSYDKISAKDAAKRLNLRv-PDEIKAFGAKRQWKLEASGD-YSftD 235 fruit fly
Q3SYT7       202 DTIRDEIAGCIEKAYEKILFTEATRILFFNt-PKKMTDYAKKRGWVLGINNY-YSfaS 257 cattle
Q4DWI7       189 STVRQEVAECIPRSYNTLSIDKAQKILMVDs-AEEVRQIGRCHNWQLSADGRSFVftR 245 Trypanosoma cruzi
XP_002631070 166 DTIRREIAASIEKSFKVLTAKDAAVMLLFDn-DQQMLKFAGERKWHLDGERFIFEveV 222 Caenorhabditis briggsae
XP_001419672 188 NTVRDEIASCAESAYGSLTGAEAMKLLGFAn-AQEFEKYANARDWTMDANGGVVf--N 242 Ostreococcus lucimarinus CCE9901
XP_001303166 163 NNTRNNHADSIEKSYEKLHINEIKKLLHFNt-IEDAQAFATKRGWTFDANGYALFkaN 219 Trichomonas vaginalis G3
XP_001581925 176 NGARLSHANSIRNAYENLTTQELAQILHLDs-PAEAAQFALARGWSLNADQTHIIfgK 232 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap